SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 324602.Caur_2548 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  324602.Caur_2548
Domain Number - Region: 63-92
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 0.00602
Family TrkA C-terminal domain-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 324602.Caur_2548
Sequence length 95
Comment (Chloroflexus aurantiacus J 10 fl)
Sequence
MSQPSLRTILVIRRGYGRRYTDLPVDELTEQQIVIDCTGGYLRPEHIDLRVDDLVYWRKQ
ERYVGARISQVQRDGHRLIALLSDTRLMPEDFFPY
Download sequence
Identical sequences A9WI63
gi|163848099|ref|YP_001636143.1| gi|222525993|ref|YP_002570464.1| WP_012258407.1.35445 YP_001636143.1.55443 2005357769 324602.Caur_2548 480224.Chy400_2749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]