SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 324602.Caur_2666 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  324602.Caur_2666
Domain Number 1 Region: 4-105
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.16e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 324602.Caur_2666
Sequence length 128
Comment (Chloroflexus aurantiacus J 10 fl)
Sequence
MDNLRIPILKIGDILIASIQVALHDASAVQFKDDLLQKIHDTRARGVIIDLTALDVVDSF
IGRLIADIAAMAGLMGARVVLTGLQPAVAITLVELGLELPRVLTALNLEKGLAMMQRMTG
EESDDGAE
Download sequence
Identical sequences A9WJG8
gi|222526126|ref|YP_002570597.1| gi|163848217|ref|YP_001636261.1| 324602.Caur_2666 480224.Chy400_2883 WP_012258525.1.35445 YP_001636261.1.55443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]