SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 324602.Caur_3065 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  324602.Caur_3065
Domain Number 1 Region: 29-203
Classification Level Classification E-value
Superfamily ClpP/crotonase 0.000000000000129
Family Biotin dependent carboxylase carboxyltransferase domain 0.067
Further Details:      
 
Domain Number 2 Region: 387-455
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000445
Family NfeD domain-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 324602.Caur_3065
Sequence length 464
Comment (Chloroflexus aurantiacus J 10 fl)
Sequence
MRYCFRQGRLHLDGNTTDRGLVTWIYRLMLVGLLWMLLATGVAAQSVQPIYFVEYDGVLS
SYAAGYLRRALREAEAANAQALIVQLTPRGAVMQEARTLAGEIAEAKVPVVVFISPAGHD
AGAAGTWLLAAAHVAAMAPESQFGIAAPLFVPAMGVSETTQELLLNEQLQQFEEWGAARQ
RDVSWADVALRSGFIATAAQAIEGSPPIIDIVARDVDELLLRLEGRVITLADGSQVTLAT
LGGRPRVVEVNLIEAVLLVLANPTVVFILLIMAGLAFYAEFLSPTVGILAGLGVILLAGA
IVGMIALPVQWLSVLGILIAFGLVAADLFVPSHGTLTVIGVGIMIASSLTLFDQVQAPGV
TVALWAVILVAVLIAIFAISGVWLALRSRNRPVTTGQEGLIGRLAEVRKRLDPEGMVFVE
GALWRAVCENGTAEEGEFVRVTGIYALRLTVRRIDTGESSPPQL
Download sequence
Identical sequences A9WGU8
gi|163848609|ref|YP_001636653.1| WP_012258917.1.35445 YP_001636653.1.55443 324602.Caur_3065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]