SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 324602.Caur_3516 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  324602.Caur_3516
Domain Number 1 Region: 255-356
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.06e-19
Family Anti-sigma factor antagonist SpoIIaa 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 324602.Caur_3516
Sequence length 370
Comment (Chloroflexus aurantiacus J 10 fl)
Sequence
MFNSIRTLLNVRHPDEEVRQRGRNIIVIALGLLGINLVVVISLLFNLSQVTRLFATSAVS
VILYIFVIFITFRGFVELAGWLTVMISLVGTLAALFVTPNGLTIIFLAVPLVLAATVLSL
RSLILVFLLTACSLAGIAFFLEPTPLSLTTRDFLIPVSLLCAFLGIVSFVQSAGNEALHR
RLQAALQQAKQTADQLRLLNDELDRRVDAQTEALQEALSELEERTLQQDRLLAEVIAQRD
VIRNLSVPVLPAGTDLLAIPLVGTIDQERLATIQQQALTAVEQRRARWLILDVTGVPFID
TGVAGGLIQLVQSVRLLGADVVLVGVRPEVAQTMVSLGIELPITHVYSDLAGAIEDLHHH
TDHSRQNNRR
Download sequence
Identical sequences A9WA18
WP_012259353.1.35445 YP_001637089.1.55443 gi|222527013|ref|YP_002571484.1| 324602.Caur_3516 480224.Chy400_3792 gi|163849045|ref|YP_001637089.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]