SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 324602.Caur_3542 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  324602.Caur_3542
Domain Number 1 Region: 256-363
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.22e-19
Family Anti-sigma factor antagonist SpoIIaa 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 324602.Caur_3542
Sequence length 370
Comment (Chloroflexus aurantiacus J 10 fl)
Sequence
MRGLVPWLLHIPNVDEDEQRRGQVIIVLALLINIITILSTPLVFIVTPQSALPLLFINIA
GFVIYTAVIVLSRIGQVYWSGALFVITITSLILTIPFGIQTDRITSYTSPFFLIFTLLVA
GMVLRPIWVWAVLIFNVSGLLVSWWLAGIPLFSGELEQTLQTAAIFLQIGTALFTFVGGQ
ITATALHEARQRREEARQIAGQLATLNATLEAQVAQRTAALQQALYELEQRAAEQARLLA
ENEQQRQAIRELSVPVLPIRETTLVMPLVGALDTARLADMQQQALEQIARANARDLFIDV
TGVPVIDTQVAKGLIQVVEAARLMGTRVTLVGIRPEVAQTLVTLGIDLHSIRTFSTLQAA
LRSERQASGQ
Download sequence
Identical sequences A9WA44
324602.Caur_3542 480224.Chy400_3821 gi|222527042|ref|YP_002571513.1| gi|163849071|ref|YP_001637115.1| WP_012259379.1.35445 YP_001637115.1.55443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]