SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 324831.LGAS_1305 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  324831.LGAS_1305
Domain Number 1 Region: 138-428
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.79e-131
Family Enolase 0.00000000508
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.94e-57
Family Enolase N-terminal domain-like 0.00000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 324831.LGAS_1305
Sequence length 432
Comment (Lactobacillus gasseri ATCC 33323)
Sequence
MSVITDIHAREVLDSRGNPTVEAEVYTELGGFGRAIVPSGASTGEHEAVELRDGDKSRFG
GQGVLTAVENVNGEIAKAVIGLDVTDQRLIDQTMIDLDGTPNKGRLGANAILSVSLASAR
AAADELGLPLYEYLGGPNAHVLPTPMMNVINGGKHADNNVDIQEFMIMPVGAKSLHEAVR
MGAETFHTLKGLLQERGESTAVGDEGGFAPNLKNNEEPFEILVEAIQRAGYKPGQDIAIA
FDCAASEFYNKDTKKYVTVADGREYTAEEWTSLIEDLVDKYPVISVEDPLDENDWEGWKT
FTERLGDKVQIVGDDLFVTNTSYLEKGIKMGVANSILIKLNQIGTLTETFEAIEMAKEAG
YTAVVSHRSGETEDTTIADLVVATNAGQIKTGSMSRTDRIAKYNQLMRIEEALGSTAQYK
GIHSFYNLHKQF
Download sequence
Identical sequences A0A087QE99 A0A1V3Y333 A0A249NJI7 D1YHF0 Q042F4
gi|116629934|ref|YP_815106.1| 324831.LGAS_1305 WP_003647015.1.100393 WP_003647015.1.1181 WP_003647015.1.12732 WP_003647015.1.258 WP_003647015.1.27557 WP_003647015.1.30511 WP_003647015.1.42744 WP_003647015.1.48812 WP_003647015.1.53875 WP_003647015.1.60404 WP_003647015.1.80685 WP_003647015.1.85201 WP_003647015.1.87492 WP_003647015.1.96447 WP_003647015.1.99755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]