SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 324925.Ppha_0074 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  324925.Ppha_0074
Domain Number 1 Region: 1-189
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.44e-44
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 324925.Ppha_0074
Sequence length 196
Comment (Pelodictyon phaeoclathratiforme BU 1)
Sequence
MQTNIILAGVGGQGILTIAAVIDQAALQSGLTIRQAEVHGMSQRGGAVQSHLRIADREIY
SDLIAEGTANLILSVEPLEALRYLPFLATNGRVVTSTEPFINMEGYPAMEEIMRELYRTN
QPILINAPELARKAGSPRTSNMIMLGAAAPFTGIDQEKLEEAIGRLFQAKGEEIVAMNIR
AFRKGVELSQPQATVS
Download sequence
Identical sequences B4SAR1
WP_012506928.1.90574 324925.Ppha_0074 gi|194335253|ref|YP_002017047.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]