SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 324925.Ppha_1645 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  324925.Ppha_1645
Domain Number - Region: 76-131
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000549
Family Sfri0576-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 324925.Ppha_1645
Sequence length 137
Comment (Pelodictyon phaeoclathratiforme BU 1)
Sequence
MAPWISKVSSCMSIHYTMRVDGDILFVCASGFDESLDEVQGYGLAIINASLEGGVSRVFC
DETALEYRLGTFDTYQAAEFIAENVPALAKVALVCNAKFMSDASFFEDVVVNRGLTLRFF
TDPEVAMRWLSEANASI
Download sequence
Identical sequences B4SAJ6
324925.Ppha_1645 gi|194336705|ref|YP_002018499.1| WP_012508369.1.90574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]