SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 324925.Ppha_2103 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  324925.Ppha_2103
Domain Number 1 Region: 438-545
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.85e-18
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 324925.Ppha_2103
Sequence length 568
Comment (Pelodictyon phaeoclathratiforme BU 1)
Sequence
MFKPKLFSILPELTPDRIMKDVIAGIMVGIVALPLAIAFAIASGVSPEKGLITAVIGGFL
VSFLGGSRVQIGGPTGAFIVILYGIVQQYGINGLVLATIMSGIILMIMGFAQFGSLIKFI
PYPVIVGFTSGIAVIIFSSQVKDFLGLDIAIVPADFIGKWSSYARNLPTFDLASFMIGTL
ALLIILFWPKLSRKIPGSLIAIVTTTVIVQYFHLDVATIESRFGEIPSMIPAPTLPSFDF
ATIQHLIMPATTIALLGAIEALLSAVVADGMIGSRHKSNMELIAQGAANIITPLFGGIPV
TGAIARTATNVKNGGRTPIAGIVHAITLLLIMLLFGKWAKLIPMPALAAILIIVAWNMSE
IKVFKQLLKSPRSDVIVLLTTFSLTVVFDLTLAIEIGMLLAVILFMQRMAQLSNVGVITK
ELTDRDEEDDPNTIVTRKVPDGVEVFEISGPFFFGAASKFREAMHIVEKAPKIRIIRMRS
VLSIDATGLNMMKELLKDCKKTETRLILSGVHAQPLFALQQYGLYDDIGEENIFGNIDDA
LDHAREILGLPKMGRQQNFVPSVQREMK
Download sequence
Identical sequences B4SD51
gi|194337133|ref|YP_002018927.1| WP_012508789.1.90574 324925.Ppha_2103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]