SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 324925.Ppha_2279 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  324925.Ppha_2279
Domain Number 1 Region: 7-197
Classification Level Classification E-value
Superfamily Formyltransferase 3.4e-54
Family Formyltransferase 0.0000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 324925.Ppha_2279
Sequence length 200
Comment (Pelodictyon phaeoclathratiforme BU 1)
Sequence
MTTNKTRIAVFCSGGGSNFKSIYRSIAEKPLNAEIVLCLSNRSQCGAMEFAHEQGIATVH
ITEKQFDSFDEFADAMVTRLKDAQIDVVLLAGYMRKVPDAVVRAFPERMLNIHPALLPKF
GGEGMYGIHVHSAVIAAGEKESGATVHFVNEEYDKGKILLQRAVPVLQGDTPEILAARVL
ACEHQLYPDALEKLLAEQRS
Download sequence
Identical sequences B4SE55
gi|194337297|ref|YP_002019091.1| 324925.Ppha_2279 WP_012508950.1.90574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]