SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 325240.Sbal_0472 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  325240.Sbal_0472
Domain Number 1 Region: 1-115
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.06e-21
Family Sfri0576-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 325240.Sbal_0472
Sequence length 121
Comment (Shewanella baltica OS155)
Sequence
MLCQIPDIAKGVISLFASGRLSSTDYRTRLQPAIKSYRKDWGQVCLYIEADVLLEGWEFE
SLTGSGEVQLPNFEALVFVGGPDWVGNAVRLLGPFMQGEVAWFPLEQKTKAIAWITKRSN
I
Download sequence
Identical sequences A0A161WQB5 A3CZT9 B8ECI8
325240.Sbal_0472 402882.Shew185_3852 407976.Sbal223_3796 gi|386339496|ref|YP_006035862.1| gi|217974945|ref|YP_002359696.1| WP_011845671.1.24904 WP_011845671.1.74325 WP_011845671.1.8014 WP_011845671.1.85636 WP_011845671.1.86146 gi|153002358|ref|YP_001368039.1| gi|126172722|ref|YP_001048871.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]