SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 325240.Sbal_3331 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  325240.Sbal_3331
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.75e-34
Family Sfri0576-like 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 325240.Sbal_3331
Sequence length 127
Comment (Shewanella baltica OS155)
Sequence
MALLKHGISIGIERYGDDDFFVAFKAIGTLTHHDYEMMVPVLESALTGVKDPDIFALVDV
TELDGLELQAAWDDLKLGVKHIRHFEKIAIVGKTTLQEVLAKLANWFTPAEVRFFVDNGD
AVAWLKD
Download sequence
Identical sequences A3D7U6
2005328345 WP_011847574.1.8014 WP_011847574.1.85636 WP_011847574.1.86146 gi|152999542|ref|YP_001365223.1| gi|386342275|ref|YP_006038641.1| gi|126175529|ref|YP_001051678.1| 325240.Sbal_3331 402882.Shew185_1008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]