SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 325240.Sbal_3850 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  325240.Sbal_3850
Domain Number - Region: 99-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00222
Family NfeD domain-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 325240.Sbal_3850
Sequence length 156
Comment (Shewanella baltica OS155)
Sequence
MEFSNPILVWAVVGLVFMLAEIVVPGGIIVLLGAACLVVAGALAIGLVEGLVQSMTLWFI
SAIVLLLTFRQVTQRLVGGDSHVDNTDEAIDLYNQIVRVKQTIGPGQTPGRVEFQGSEWP
ALGDGTTIAAGTEVRIICRENIALVVEPISIEASKN
Download sequence
Identical sequences A3D9A8
325240.Sbal_3850 gi|126176041|ref|YP_001052190.1| gi|386342797|ref|YP_006039163.1| WP_011847955.1.8014 WP_011847955.1.86146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]