SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 326297.Sama_0414 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  326297.Sama_0414
Domain Number - Region: 107-150
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00301
Family NfeD domain-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 326297.Sama_0414
Sequence length 155
Comment (Shewanella amazonensis SB2B)
Sequence
MEFSNPVLIWAGIGVVLMLAEVIVPGGIVILLGAACLVVSGALGLGLVDGFIQSMTLWFI
ASMVLLLGFRHITQRLVGGDSHVDNTDEALDIYNQTALVKADIGPGEKAGRVEFQGADWP
ALGDGTLIPSGTQVRVICRENISLIVEALPAQHIV
Download sequence
Identical sequences A1S2L8
326297.Sama_0414 gi|119773554|ref|YP_926294.1| WP_011758534.1.25267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]