SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 326297.Sama_1023 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  326297.Sama_1023
Domain Number 1 Region: 106-282
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.59e-22
Family Clp protease, ClpP subunit 0.058
Further Details:      
 
Domain Number 2 Region: 458-517
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000719
Family NfeD domain-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 326297.Sama_1023
Sequence length 529
Comment (Shewanella amazonensis SB2B)
Sequence
MFNRLFNRLFSPEVVRLLASINRLFASKPGLFALLLPLLLGSLNSGVVASPHAAFSSGFI
LSNANIANTTPVSDRDIGSNHSADLAAAVTSHQNTGARGLEGTVAPIWLLEVKGAIGPGV
ADYLVRTLNKAQKQVVPPQLLLLTLDTPGGLVASLRDINQAILTSEIPVACLVYPAGARA
ASAGTYMLYACHLAAMAPATSLGAATPVQLGPPAGGEPKDKEAEQQGASDMERKILNDAV
AYIRTLAQLRGRNAEWGEQAVREAATATASEALALGAIDLIAKDPYALLEAIDGRQFVIN
DTVRVLHTHKALLLDAKPDWRTTFLSTITNPNVAYVLMMLGIYGLLLEFYSPGMGISGVV
GAICLLVAMFALQMLPINYAGAALLILGIGLLVAESLVPSFGILGFGGVVAFVLGSVFLI
DSELDAFRIAWPVILALAMVSLLFFAVLVSLLFKQRHRAVVSGPEAMVGARALVLDGFPG
KGQVLFMGERWQGHSEQALQSGTWVRVESISGLLLELGPLDESKEKQDE
Download sequence
Identical sequences A1S4C4
326297.Sama_1023 gi|119774160|ref|YP_926900.1| WP_011759139.1.25267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]