SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 326297.Sama_1957 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  326297.Sama_1957
Domain Number 1 Region: 1-118
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.08e-27
Family Sfri0576-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 326297.Sama_1957
Sequence length 122
Comment (Shewanella amazonensis SB2B)
Sequence
MIRLKPGFDHDTIALEASGMIEADDYSRVLIPALEQALKDHASVRIWYEIADGCRGVSLL
SLWQDVLLGLFHLDDFRRIAILTNRPAFRRMGELIGLFMPCPVCVFSLDEVQIAKIWLCQ
SR
Download sequence
Identical sequences A1S706
326297.Sama_1957 gi|119775092|ref|YP_927832.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]