SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 326297.Sama_1990 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  326297.Sama_1990
Domain Number 1 Region: 413-497
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000275
Family Anti-sigma factor antagonist SpoIIaa 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 326297.Sama_1990
Sequence length 518
Comment (Shewanella amazonensis SB2B)
Sequence
MFELIRHKTASHKADLLSGLTVALALVPEAVAFAFVAGVEPMVGLYAAFIMGLVTAMIGG
RPGMISGATGAMAVVMVALVATHGVQYLFAAVVLAGLLQVAAGIFKLGKFIRIVPYPVMI
GFVNGLAIVIFLAQLGQFKVPGDNGELTWLTGDGLYLMLGLVALTMAIIHFLPKLTTAIP
SSLAAILTVTGLVVFFELDTRTVVDFLKTMSGDDNATIAGTLPTFAIPHVPFTWETLQII
LPYSVILAAVGLIESLLTLTVLDEMTGTRGRGNKECVGQGVGNITSGFFGAMGGCAMIGQ
SMININSGGRGRLSGITAALALLTFILFGAAFIEIIPLAALVGVMFMVVLGTFEWASFKV
MRKVPKHDAFVIVLVTTVTVFTDLAVAVFVGVIVSALVFAWEHAKHISARTVINANGSKV
YQLSGPLFFGSVSHFLELFDAANDPKDVIVDFGQSRVADHSALDAIDTLAERYNTLGKTL
HLVHLSEDCKALLAKAGDLVEVNLLEDPHYRVADDKLD
Download sequence
Identical sequences A1S739
WP_011760103.1.25267 gi|119775125|ref|YP_927865.1| 326297.Sama_1990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]