SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 326297.Sama_2481 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  326297.Sama_2481
Domain Number - Region: 112-130
Classification Level Classification E-value
Superfamily YwmB-like 0.051
Family YwmB-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 326297.Sama_2481
Sequence length 144
Comment (Shewanella amazonensis SB2B)
Sequence
MFRQLFAALLLTASLCGIASAEQKEQVGQFDIHYMALPSTFLTPAIAKNYGIERSNYTGI
VNIAVLDTAEEGNPAVAVEISGIANNLLDAKVELKFREIREGAAIYYIAEVPYRSDEEIN
FQIALRSGNKLNTTLKFKQKFYVD
Download sequence
Identical sequences A1S8H8
326297.Sama_2481 WP_011760591.1.25267 gi|119775614|ref|YP_928354.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]