SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 326297.Sama_2879 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  326297.Sama_2879
Domain Number 1 Region: 53-141
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 8.63e-16
Family Pentapeptide repeats 0.0025
Further Details:      
 
Domain Number 2 Region: 232-327
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000000549
Family Voltage-gated potassium channels 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 326297.Sama_2879
Sequence length 327
Comment (Shewanella amazonensis SB2B)
Sequence
MNEKIPVCCYHEDEGFSCSEPAGPSGLCYWHDPRITKDGPDDKAKLEAYARKGGMLRGIH
LKRAELAGIDLVKHHSKTGYDMSHAELYRANLNGAHLFNLNLENASLMKADLREANVHCA
NLVNTNLLGIKWMGAKIENINTGKLLKQERMAMEAERVGEMEIALDYFEQAEEIYRDLRK
AAEREGLFAMGGHFIQRELTMRRHQLPKYSRARLTSKIIDLFCGYGESPGRVIGFSMVLI
LICAICYFFTGLSYGGNIHVFKPENTFMMNFYLFFNCIYYSVVTFTTLGYGDFTPIGFSR
LIAAIEAFTGSFTIALFVVVFVKKMTR
Download sequence
Identical sequences A1S9M5
326297.Sama_2879 gi|119776011|ref|YP_928751.1| WP_011760987.1.25267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]