SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 326298.Suden_0096 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  326298.Suden_0096
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.7e-44
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 326298.Suden_0096
Sequence length 185
Comment (Thiomicrospira denitrificans ATCC 33889)
Sequence
MLEIRWHSRAGQGAVTGAKGLADVISTTGKHVQAFAFYGSAKRGAAMTAYNRVDDKVIMN
HEKYMKPDYVFVIDPALVFTSDVTINHKDSTKYIITTHLTTEELIKAQPKLEGKEVYTVD
CITIANETIGRPIPNTPMLGAFMKVSKMYDIEFFKESMQRILGKLPQKIIDANMFAIQRA
YDEVK
Download sequence
Identical sequences Q30UF4
gi|78776297|ref|YP_392612.1| WP_011371732.1.32152 326298.Suden_0096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]