SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 326423.RBAM_007320 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  326423.RBAM_007320
Domain Number 1 Region: 175-282
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.49e-16
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 326423.RBAM_007320
Sequence length 294
Comment (Bacillus amyloliquefaciens FZB42)
Sequence
MKEETAVNKDQLLHDYIITHSAELTEKWLKLRRKLRGRFYSADQLSEEMKQLLIEQHTFT
NTVIASAFLEDPAVFQHNKEKWAAQVAKSRVEQDAEVHEVVEAIGNSRTVFWEAVTRFMD
EHQDIVTNEDARRWNHLVNGSFDQLMTDFTEQFQKLMIARLSSQQELISELSCPVILIAD
TIGTLPLIGSIDTRRARVILESVPENCVAKRITNLVIDLSGVPIVDTMVAQQLYMLSKTL
FLLGIRTVFSGIRPDVAQTSIQLGLDFSEYQTYGSLEQALASMGVTCVFEEAKA
Download sequence
Identical sequences A7Z291
gi|154685187|ref|YP_001420348.1| 326423.RBAM_007320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]