SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 326423.RBAM_023080 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  326423.RBAM_023080
Domain Number 1 Region: 158-265
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.73e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 326423.RBAM_023080
Sequence length 276
Comment (Bacillus amyloliquefaciens FZB42)
Sequence
MKHLSETLSRTLIEESGEITRQWLLIPKSGRPSDDQKAEMQHRLLIEIVAGILSEKDGGE
EELTKWALQFARDRAVHEVPVYESVTSFKEFRRLVWNRIQTCCETMSEKPGANAVFQWGE
KLNKAIDHMIEVFTEEYYKVTVTQLNAQKEMINELSAPIMPIADGIGILPLVGEIDTYRA
KMILESVLDQCSSLRLSYLFLDISGVPIVDTMVAYQIFKVIDSTKLLGIETTISGIRPEI
AQTVVKLGIDFSQVKTEQSLAKALAKNGFIVKESLR
Download sequence
Identical sequences A7Z6P3
gi|556558130|ref|YP_008727665.1| gi|154686739|ref|YP_001421900.1| 326423.RBAM_023080 WP_012117987.1.37657 WP_012117987.1.44318 WP_012117987.1.54902 WP_012117987.1.80280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]