SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 326423.RBAM_023690 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  326423.RBAM_023690
Domain Number 1 Region: 14-195
Classification Level Classification E-value
Superfamily ClpP/crotonase 6.01e-25
Family Clp protease, ClpP subunit 0.045
Further Details:      
 
Weak hits

Sequence:  326423.RBAM_023690
Domain Number - Region: 378-437
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000124
Family NfeD domain-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 326423.RBAM_023690
Sequence length 438
Comment (Bacillus amyloliquefaciens FZB42)
Sequence
MFRKKTGIAVALLGLFVLSLLGVQLNAKADHPSVYVIPVEKNVEQGLASFLSRSFKEAKE
SGASHIILDINTPGGAVQSALDIADIIGRADVPVTAYVNKRALSAGAYIALQADEIYMAP
GGKMGAAAIIDGKGNAADKKAQSLWHAEMEDAAVKNNRNPKYALAMADPAINAKEAGAPK
GKLLTLTAEKAKEVGYSEGTVSDLDALYTKLGFDKADVHHAKEGFVGKLGRWLTNPFVVP
VLLTLALLGLTIELFSPGLGIPGAVGLTAMLLFFTGHIAAGFAGYDSVFLFCAGLVFILL
EIFLPGGIIGLIGIAGVIASLFLAAGSFTVMAVSLLIAIAVSITAFIILTRVLGKRMKFF
KKLILTDSTSTESGYVSNQNRTELLGKVGVTATALRPSGTVIIDDERLDVVSEGSFTEKD
RQVKVVKAEGSRIVVREI
Download sequence
Identical sequences A0A2I5K033 A7Z6V3
gi|154686799|ref|YP_001421960.1| 326423.RBAM_023690 WP_012118019.1.37657 WP_012118019.1.39952 WP_012118019.1.44318 WP_012118019.1.80280 WP_012118019.1.90093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]