SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 326424.FRAAL1051 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  326424.FRAAL1051
Domain Number 1 Region: 269-535
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.38e-61
Family Pyruvate oxidase and decarboxylase Pyr module 0.036
Further Details:      
 
Domain Number 2 Region: 46-252
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.01e-18
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.018
Further Details:      
 
Domain Number 3 Region: 555-655
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000569
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 326424.FRAAL1051
Sequence length 656
Comment (Frankia alni ACN14a)
Sequence
MRSVGPARRTRPIATAGRLVWYPRRLLKVSEQVRERETRRLDRVVVRFAGDSGDGMQLTG
EQFTSETATFGNDLSTLPDFPAEIRAPAGTPAGVSGFQLHFSDHDILTPGDAPDVLVAMN
PAALKANLKDLPPGANLIVNTDAFTGGNLKKAGYATDPLTDGTLDPYLVHRVPLTSMTIN
AVHAAEETAGSVNKKEAERAKNMFALGLMSWLYHRPTEGTVGFLEKKFAKRPEIAAANIA
AFRAGFNYGETTESFTVTYEVAPARMKSGTYRRITGNLALSYGLIAAGELTGLPVFLGSY
PITPASDILHELSKHKRFGVRTFQAEDEIAGIGAALGASFGGSLGITTTSGPGVALKSET
IGLAVSLELPLVVVDIQRGGPSTGLPTKTEQADLLQAMFGRNGEAPVPIVAPRSPGDCFD
AAVEAARLATKYRTPVFLLSDGYLANGSEPWLLPKREALPDLTVAFTTEPNHTGPKGPEF
WPYLRDPETLARPWAVPGTPGLEHRIGGIEKSDGQGNISYDPANHDRMVRLRAAKVAGIA
NDIPPLEVEDPSGQARVLVLGWGSTYGPIAAGCRRVRAKGLHVAQAHLRHLNPFPANTGE
ILRSYDKVLIPEMNLGQLRTLIRAEFLVDAIGYNQVRGLPFKAAELAGVLEDVINQ
Download sequence
Identical sequences Q0RRU9
gi|111220518|ref|YP_711312.1| 326424.FRAAL1051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]