SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 326424.FRAAL2084 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  326424.FRAAL2084
Domain Number 1 Region: 1-141
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.07e-28
Family Potassium channel NAD-binding domain 0.0027
Further Details:      
 
Domain Number 2 Region: 130-208
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 0.00000000000222
Family TrkA C-terminal domain-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 326424.FRAAL2084
Sequence length 224
Comment (Frankia alni ACN14a)
Sequence
MIAGAGKVGRSIAAELLENGSEVLIIERDPQKIRADALPDARWLLADACELSQLDAAGLN
ECTVLVAATGDDKVNLVVSLLAKTEFGVPRVVARVNHPKNEWLFTESWGVDVAVSAPRLL
TALVEEAVSVGDLVRLMRFRQSDASLVELTLAEDAPVVGLRISEITLPPDTALVVILRDG
RAVIPSPDATLEHGDEVLAVATSSEAEEQLAALLGPVPEQTLRG
Download sequence
Identical sequences Q0RP02
gi|111221519|ref|YP_712313.1| WP_011603250.1.24492 WP_011603250.1.38265 326424.FRAAL2084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]