SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 326424.FRAAL2119 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  326424.FRAAL2119
Domain Number 1 Region: 79-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000523
Family NfeD domain-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 326424.FRAAL2119
Sequence length 144
Comment (Frankia alni ACN14a)
Sequence
MADWAIWVVVAGALLVGELLTLDLTLVMFSLAALVGAAVAVLGVDVAWQIVGFVVAAGGF
GLGLRPVARRHLQRGPELRTGTEALLGEQALVVEQVSGDGGRVKIKGEVWSARSYPTTTV
LEVGSQAHVLRIDGATAIVHRFEI
Download sequence
Identical sequences Q0RNW8
326424.FRAAL2119 WP_011603284.1.38265 gi|111221553|ref|YP_712347.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]