SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 326424.FRAAL3472 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  326424.FRAAL3472
Domain Number 1 Region: 3-52
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0000523
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 326424.FRAAL3472
Sequence length 113
Comment (Frankia alni ACN14a)
Sequence
MGTPNTALLGGFAALTGAVSLAAAETAIRECLSGRLVHDTIEAARDAFAYVRYQQRERAS
PPPRRRPRRGWHRGCRHRGCRHRGCRHRRGRHVAWPRAVEAGYLIAPGRGLRR
Download sequence
Identical sequences Q0RK44
326424.FRAAL3472 gi|111222885|ref|YP_713679.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]