SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 326427.Cagg_0179 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  326427.Cagg_0179
Domain Number 1 Region: 248-353
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.49e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 326427.Cagg_0179
Sequence length 359
Comment (Chloroflexus aggregans DSM 9485)
Sequence
MQESSFATLSVAQVRQLQRFFLWVVGIVGAVAIVATVTALIWQTATVIALMILDWVLVIG
VLQAWAQTRSGQVRVALTTAFVAIVGYGLIGAIVVPSVANLMAFAPIVAVVSMLPFLSGV
MLRRLLIIAWIAVIVTLLLGTQIRLLPPIPDVLTVSFQVVGVLAVSAILLLQLWLFHERL
FGVINQLRLVNEDLQRERAGLQERVAQRTADLERALAEVEHQMAEQARLLSENERQRELI
RGLSMPVLPVSSETLVMPLVGELDEGRIALAQSTALQAIDQMHARHLVLDITGMPFVDTT
VAGGLIRLVQAAHLLGARVTLVGVRPEVAQTMVALGIDLASVATAADLASALRREPITK
Download sequence
Identical sequences B8GCT0
gi|219847133|ref|YP_002461566.1| 326427.Cagg_0179 WP_012615496.1.86148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]