SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 326427.Cagg_0577 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  326427.Cagg_0577
Domain Number 1 Region: 270-376
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.87e-18
Family Anti-sigma factor antagonist SpoIIaa 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 326427.Cagg_0577
Sequence length 385
Comment (Chloroflexus aggregans DSM 9485)
Sequence
MTLVNYNCRVVNLAIVFISMTDIFHKLLDVRHSDEESRQRGRNIVIIALGLLVINLIVAM
TIIVAFTESVSLLVSTSLSSILYAGIIFLTRRGFIDVGGWLTVGTALIGTTIASFASPDH
PIVAFLTVPLVLAATLLRFRDVIVVFGLVLLAMGSLASFAEPTLITITSEAFLLTSAILC
GFIAVISFVQSFGNEVLHRRLQTALQQTQQSAHELQQLNAELDRRVALQTETLHMALQEL
EERSRQQDRLLAEVIAQRDVIRQLSVPVLPVGPATLVMPLIGTIDRDRLTTIQQQALTAI
GQQHARWLILDVTGVPVIDTEVAGGLIQAVQSVRLLGADVVLVGVRPEVAQTMVSLSIEL
PITHVYSDLASAIESVAHRAVNARR
Download sequence
Identical sequences B8G4B0
326427.Cagg_0577 WP_012615882.1.86148 gi|219847519|ref|YP_002461952.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]