SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 326427.Cagg_1013 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  326427.Cagg_1013
Domain Number 1 Region: 21-196
Classification Level Classification E-value
Superfamily ClpP/crotonase 0.0000000000000421
Family Biotin dependent carboxylase carboxyltransferase domain 0.091
Further Details:      
 
Domain Number 2 Region: 379-447
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000772
Family NfeD domain-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 326427.Cagg_1013
Sequence length 455
Comment (Chloroflexus aggregans DSM 9485)
Sequence
MVQHRLSPYPTPQWRSVWRYFIIGLLWSVLVTGIAAQSTQPVYVAEYEGVLSTYAAGYLR
RALHEAEAANAQVLVMQLTPHGAVLEEVRKLANDIANARVPVVVYIGPSGHDAGAAGSWL
LPAAHIAAMAPDSRFGIATPLFVPTMGMSNDTQELLLNEQLQQFEVWGQAHNRNVDWADT
ALRSGFIATAAQAIEAQPPIIDLVARDRTELLQRLEGRVVTLADGRQITLATLGARPFVV
EVNLLEAFLIVLANPTVVFLLLIMAGLAFYAEFLSPTVGILAGLGVLLLIGAIIGMIALP
VQWLSVLGILIAFGLIAADLFVPSHGTLTVIGVGIMIASALTLFDATQAPGVVVALWVII
LVAMIIAIFAVTGVWLALRSRNRPVTTGQEGLIGRLAEVRQRLDPEGMVFVEGALWRAVC
ENGTAEAGEWVRVTGIYALRLTVRRLEPSELSSPS
Download sequence
Identical sequences B8G6J1
gi|219847931|ref|YP_002462364.1| 326427.Cagg_1013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]