SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 326427.Cagg_1708 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  326427.Cagg_1708
Domain Number 1 Region: 334-438
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000177
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 
Domain Number 2 Region: 184-286
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000078
Family Heme-binding PAS domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 326427.Cagg_1708
Sequence length 444
Comment (Chloroflexus aggregans DSM 9485)
Sequence
MLLTCAGAVRFSSRNLDEIWLLSGLLTSLQAVIFGFLIWLIMLLFMPHRYQQPWLRWAVF
TPYLLMAVGLVIDWYGRFGFVGRDVVRETSGLLGFVRGPAFVPAFTLYIIGCIVIPLIML
ITIAIRQPAMRGPAVWLIIGTILTFLMGYIFREIGLVSVTYVSLLPLHLSFGWVTLRYGV
FRPSQVALQAAVEHLPDGMLVLDTQRQIRYANRAAQRIIAGNDRNEQSFEQALAQAGFIE
QTSTEDRERQRRRFFRPTDQTILLATEVPINDAQGGASVVLIRNVTRAEQQQAELIASRA
ALAERTAELERSLAELQQRDELLRRLSLPIIPLSATMVVVPLIGIFDAARCQSLLQLILP
EIAERNAKMVLVDLTGLTAFDQTLAHTLYQLRDGAHLMGTQIFLCGIRPDLAEVMIHAGG
IWSGLRSFATLQDGVKALLTNTIL
Download sequence
Identical sequences B8GAM0
WP_015940468.1.86148 gi|219848612|ref|YP_002463045.1| 326427.Cagg_1708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]