SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 326427.Cagg_3652 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  326427.Cagg_3652
Domain Number 1 Region: 207-477
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.65e-61
Family PFOR Pyr module 0.0042
Further Details:      
 
Domain Number 2 Region: 13-226
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.23e-19
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.022
Further Details:      
 
Domain Number 3 Region: 490-597
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000608
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 326427.Cagg_3652
Sequence length 605
Comment (Chloroflexus aggregans DSM 9485)
Sequence
MQFSQSTVNEFAITAATINGSGSQTANMVLMRAIFLMGIPVSGKNLFPSNIQGEPTWYTL
RVSQAGYTARPAQSQLLVAFNPRTANDDLANLVTGGICLYPADGPWQPQRSDIIPVALPV
RQLLEQTGVSQRLRTYAANMVYVGALAALLGITDTALVKAVQHQFRGKATTVELNLAVIR
AAKEWMSNTDTPAHGRFRVEPLAATTDLMLIDGNTAAAIGAITGGVGVVAWYPITPSTSL
IESLESYLPRLRDHNQGATCAIVQAEDEIAALGIVIGAGWAGARAMTATSGPGISLMTEF
AGLGFFAEIPAVIWDVQRVGPSTGLPTRTAQGDLLSVYYLGHGDTRHVVLLPGTMEECYS
DAQQAFDLAEYLQTPVFVLSDLDLGMNIWMSRPFTYPEQPLQRGKVLSAEDLAKLTTYAR
FADVDGDGIGYRTLPGNPHPLAATLSRGTGHNERNVYSERPEDWQRNMARLWRKHETARR
LVPRPVIDAHPEATIGLIGFGSTAPAIAEARDLLAATGIVTSSMRVRALPLGPEVTDFIA
RHRYCVVIEQNHDGQLRQLLQLHCPAYATRLGSVAWCDGLPLTAPFVRDQVLHVLEQMHV
TTPIM
Download sequence
Identical sequences B8GAB3
WP_015942333.1.86148 gi|219850491|ref|YP_002464924.1| 326427.Cagg_3652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]