SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 326442.PSHAb0271 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  326442.PSHAb0271
Domain Number - Region: 117-148
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0405
Family NfeD domain-like 0.015
Further Details:      
 
Domain Number - Region: 33-88
Classification Level Classification E-value
Superfamily Fumarate reductase respiratory complex transmembrane subunits 0.0654
Family Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 326442.PSHAb0271
Sequence length 150
Comment (Pseudoalteromonas haloplanktis TAC125)
Sequence
MEFITQNLPQTLMVLGVLALIIEVAVLGLSTFILLFFGLSLFITGLLMSMGILADSMTTA
LWSNTLITAAISILLWKPLKRMQNNVERKPVNSDFAELTFVLNQDVTIEGLSTHQYSGIS
WQLKSKQPISAGTQVKVTKKEVGVMWVQSI
Download sequence
Identical sequences A0A1R4JAE8 A0A221IR40 Q3IBU2
gi|77362184|ref|YP_341758.1| 326442.PSHAb0271 WP_011329901.1.32499 WP_011329901.1.36504 WP_011329901.1.42639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]