SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 329726.AM1_1451 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  329726.AM1_1451
Domain Number - Region: 11-45
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00732
Family NfeD domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 329726.AM1_1451
Sequence length 62
Comment (Acaryochloris marina MBIC11017)
Sequence
MILPGSSVRVVNTGDTYFGFEGQVQRVADGQAAVIFDGGNWTKIVTFRLPELEIVKRGKG
KK
Download sequence
Identical sequences B0C7T8
WP_010468488.1.53659 WP_010468488.1.67183 329726.AM1_1451 gi|158334621|ref|YP_001515793.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]