SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 329726.AM1_3619 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  329726.AM1_3619
Domain Number 1 Region: 93-282
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.41e-23
Family MraW-like putative methyltransferases 0.062
Further Details:      
 
Weak hits

Sequence:  329726.AM1_3619
Domain Number - Region: 6-67
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.093
Family DBL homology domain (DH-domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 329726.AM1_3619
Sequence length 308
Comment (Acaryochloris marina MBIC11017)
Sequence
MHSTRPLSISVIDELIQEILRINKLQSNFLADAVQTLSKSDIQLFSQYLNYCLDQQLTLG
YLAKCYDLIVKDTFTQQLYFKRHGHYKHSSYAEVESLVYRNADYMSMYMYGLAITTFLWP
NHAQMKQFFKEMLPKTQSGRYLEIGPGHGFHMMEAMQHSQYDQFLGIDISPTSVLLTQKI
LSSHYFGQFENYDIKECDFLTWEPSDQYDAVVMGEVLEHVEQPQQFLQKIAALTHGNSHI
HVTTCINSPAIDHIYLFKHAQDIANMVKASGLYIKHQLLIPYQSTTLATSEQDKLPINIA
LILGKVDA
Download sequence
Identical sequences B0C3B0
WP_012164002.1.67183 gi|158336751|ref|YP_001517925.1| 329726.AM1_3619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]