SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 329726.AM1_3717 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  329726.AM1_3717
Domain Number 1 Region: 403-488
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000051
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 329726.AM1_3717
Sequence length 497
Comment (Acaryochloris marina MBIC11017)
Sequence
MNIPNLNLNWRALKREWLVNPKADLLSGAVVGLALIPEAIAFSIIAGVDPKVGLYASFII
AVITSFLGGRPGSISAATGAMALLMVDLVKEHGLQYLLAATFLTGIFQVIFGILQLGRQM
KFVPRAVMIGYINALAVLIFMAQLPQLTNVPPTVYVLTVLSLGIIYILPRFTKAVPSPLV
ALAVMTIAAIALRLDVPTVGDMGELPTTPPLFALPQVPFNLETFNIILPYSLTLAIVGLL
ASFLTASLVDDLTDTPSDKNQEAKGQGVANMVTAFFGGMAGCGMIGQSVINVQSGGRGRL
SSLAAGIFLLGAILFLQDWVRQMPMAALVAVMIMVSIGTFRWSSFTNIPRVPRSEVVVML
TTMFVIIFTRNFALGVATGIVMSTVFFSRKIAQLVLVDQVMLDDGAHRVYKVSGQIFFLS
RDEFMASFNFAELVEQVTIDLTHAHLWDQGAVEMLDKAVQKFRRQGVEVNVVGLNEASST
LLNRLATDEELISNDPS
Download sequence
Identical sequences B0C4G3
329726.AM1_3717 gi|158336849|ref|YP_001518023.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]