SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 329726.AM1_3753 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  329726.AM1_3753
Domain Number 1 Region: 113-306
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.19e-40
Family D-glucarate dehydratase-like 0.00085
Further Details:      
 
Domain Number 2 Region: 2-96
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.47e-21
Family Enolase N-terminal domain-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 329726.AM1_3753
Sequence length 307
Comment (Acaryochloris marina MBIC11017)
Sequence
MEFSYQTYQRSFQQPLQTRYGPWSIRRGLMVMLEDDAGNIGQGEIAPLSWFGSETWEQAQ
TYCQQLPRQLTDAHILSIPDRYPACQFGLGSAWEALHQNSVSASVFPEICGLLPTGSSAL
SAASKLWEQGYRTFKWKIGVDAIEQEQAIFRRLIVALPPQALLRLDANGGLTNESACRWL
QLCDQVMDTLRIEYLEQPLPPEQLSAMLSLSQQFQTPLALDESVATLSQLQHCVQQGWNG
IFVIKPAICGYPHRLRQFCQSHPIDAVFSSVFESEVGRQACLRLAAELSNPQRAIGFGVC
HWLSPDE
Download sequence
Identical sequences B0C5M2
329726.AM1_3753 gi|158336885|ref|YP_001518060.1| WP_012164122.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]