SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 329726.AM1_C0324 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  329726.AM1_C0324
Domain Number 1 Region: 14-75
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000211
Family Phage repressors 0.058
Further Details:      
 
Domain Number 2 Region: 69-131
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 0.0000314
Family DnaJ/Hsp40 cysteine-rich domain 0.0047
Further Details:      
 
Weak hits

Sequence:  329726.AM1_C0324
Domain Number - Region: 124-147
Classification Level Classification E-value
Superfamily NOB1 zinc finger-like 0.000288
Family NOB1 zinc finger-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 329726.AM1_C0324
Sequence length 160
Comment (Acaryochloris marina MBIC11017)
Sequence
MQRLESSSVPQAGESLGDYVHRLRTTLGLSQKEVAIKAGVHAQSYGKLERNKTSSLNRKT
KQGLAAALQIPSDYLDAVCRGTVVSPNQGIRFCPHCWRPGTPPDSIWLHSRAQYCYVCGT
QLRDRCVNCNEQIASLKHRFCPYCGTAYQALKALHVEKEG
Download sequence
Identical sequences A8ZN53
329726.AM1_C0324 WP_012167568.1.67183 gi|158340397|ref|YP_001521753.1| gi|158340397|ref|YP_001521753.1|NC_009928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]