SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 330779.Saci_2228 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  330779.Saci_2228
Domain Number 1 Region: 4-183
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.83e-30
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 330779.Saci_2228
Sequence length 188
Comment (Sulfolobus acidocaldarius DSM 639)
Sequence
MARVNILLAGVGGQGIITMGKMIAEAGNYCNVKVLVAETHGLAQRGGAVNVHVRIGDVNS
PLIPLGGADYLVGLEATEVLRNLNYCSKNTVIVLNNYVLRPVLPKVRLLEIREVLDRLKG
LNVHLINAYEIAEKAGNTKAVNAALLGYLYSIGAFKGLLTEEAFYKSLKYESNVKAFQSA
KSAFAHLL
Download sequence
Identical sequences A0A0U3F977 M1IU78 M1J4T6 Q4J6R8
WP_011279016.1.100797 WP_011279016.1.13097 WP_011279016.1.15291 WP_011279016.1.18585 WP_011279016.1.18739 WP_011279016.1.19907 WP_011279016.1.20267 WP_011279016.1.24072 WP_011279016.1.28054 WP_011279016.1.29213 WP_011279016.1.30898 WP_011279016.1.31299 WP_011279016.1.3283 WP_011279016.1.33024 WP_011279016.1.33782 WP_011279016.1.34459 WP_011279016.1.34536 WP_011279016.1.35781 WP_011279016.1.35800 WP_011279016.1.36276 WP_011279016.1.37881 WP_011279016.1.38112 WP_011279016.1.38253 WP_011279016.1.39308 WP_011279016.1.39398 WP_011279016.1.43265 WP_011279016.1.4394 WP_011279016.1.45682 WP_011279016.1.48356 WP_011279016.1.49892 WP_011279016.1.50721 WP_011279016.1.51246 WP_011279016.1.5150 WP_011279016.1.53520 WP_011279016.1.55288 WP_011279016.1.55517 WP_011279016.1.56706 WP_011279016.1.57256 WP_011279016.1.64117 WP_011279016.1.64360 WP_011279016.1.67449 WP_011279016.1.68798 WP_011279016.1.7301 WP_011279016.1.74875 WP_011279016.1.78046 WP_011279016.1.78998 WP_011279016.1.8042 WP_011279016.1.83345 WP_011279016.1.87279 WP_011279016.1.90653 WP_011279016.1.90680 WP_011279016.1.95134 WP_011279016.1.96274 WP_011279016.1.97501 gi|449070501|ref|YP_007437582.1| 330779.Saci_2228 gi|449068183|ref|YP_007435265.1| gi|70607937|ref|YP_256807.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]