SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 330779.Saci_2330 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  330779.Saci_2330
Domain Number 1 Region: 54-114
Classification Level Classification E-value
Superfamily NfeD domain-like 2.62e-17
Family NfeD domain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 330779.Saci_2330
Sequence length 120
Comment (Sulfolobus acidocaldarius DSM 639)
Sequence
MVVHDPVSIIIIVVVILALILTGQYANPIVAIPSLALVGFLLYRVVNVIWTTRRRNLYTY
EGKIGRAVDDISPGKEGYVLIEGEYWRAISNEPISKGDEVIVIGMQNLKLIVKKYIRVRG
Download sequence
Identical sequences A0A0U3H3V3 M1IUF6 M1J561 Q4J6G7
gi|70608037|ref|YP_256907.1| 330779.Saci_2330 gi|449070601|ref|YP_007437682.1| WP_011279116.1.100797 WP_011279116.1.13097 WP_011279116.1.15291 WP_011279116.1.18585 WP_011279116.1.18739 WP_011279116.1.19907 WP_011279116.1.20267 WP_011279116.1.24072 WP_011279116.1.28054 WP_011279116.1.29213 WP_011279116.1.30898 WP_011279116.1.31299 WP_011279116.1.3283 WP_011279116.1.33024 WP_011279116.1.33782 WP_011279116.1.34459 WP_011279116.1.34536 WP_011279116.1.35781 WP_011279116.1.35800 WP_011279116.1.36276 WP_011279116.1.37881 WP_011279116.1.38112 WP_011279116.1.38253 WP_011279116.1.39308 WP_011279116.1.39398 WP_011279116.1.43265 WP_011279116.1.4394 WP_011279116.1.45682 WP_011279116.1.48356 WP_011279116.1.49892 WP_011279116.1.50721 WP_011279116.1.51246 WP_011279116.1.5150 WP_011279116.1.53520 WP_011279116.1.55288 WP_011279116.1.55517 WP_011279116.1.56706 WP_011279116.1.57256 WP_011279116.1.64117 WP_011279116.1.64360 WP_011279116.1.67449 WP_011279116.1.68798 WP_011279116.1.7301 WP_011279116.1.74875 WP_011279116.1.78046 WP_011279116.1.78998 WP_011279116.1.8042 WP_011279116.1.83345 WP_011279116.1.87279 WP_011279116.1.90653 WP_011279116.1.90680 WP_011279116.1.95134 WP_011279116.1.96274 WP_011279116.1.97501 gi|449068283|ref|YP_007435365.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]