SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 331111.EcE24377A_1561 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  331111.EcE24377A_1561
Domain Number 1 Region: 794-1166
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.39e-118
Family PFOR PP module 0.0000000342
Further Details:      
 
Domain Number 2 Region: 419-668
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 6.54e-77
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000122
Further Details:      
 
Domain Number 3 Region: 2-254
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.88e-71
Family PFOR Pyr module 0.0000000976
Further Details:      
 
Domain Number 4 Region: 256-411
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.86e-43
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000197
Further Details:      
 
Domain Number 5 Region: 665-838
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 6.7e-23
Family Ferredoxin domains from multidomain proteins 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 331111.EcE24377A_1561
Sequence length 1174
Comment (Escherichia coli E24377A)
Sequence
MITIDGNGAVASVAFRTSEVIAIYPITPSSTMAEQADAWAGNGLKNVWGDTPRVVEMQSE
AGAIATVHGALQTGALSTSFTSSQGLLLMIPTLYKLAGELTPFVLHVAARTVATHALSIF
GDHSDVMAVRQTGCAMLCAANVQEAQDFALISHIATLKSRVPFIHFFDGFRTSHEINKIV
PLADDTILDLMPQAEIDAHRARALNPEHPVIRGTSANPDTYFQSREATNPWYDAVYDHVE
QAMNDFSAATGRQYQPFEYYGHPQAERVIILMGSAIGTCEEVVDELLTRGEKVGVLKVRL
YRPFSAKHLLQALPGSVRSVAVLDRTKEPGAQAEPLYLDVMTALAEAFNNGERETLPRVI
GGRYGLSSKEFGPDCVLAVFAELNAAKPKARFTVGIYDDVTNLSLPLPENTLPNSAKLEA
LFYGLGSDGSVSATKNNIKIIGNSTPWYAQGYFVYDSKKAGGLTVSHLRVSEQPIRSAYL
ISQADFVGCHQLQFIDKYQMAERLKPGGIFLLNTPYSADEVWSRLPQEVQAVLNQKKARF
YVINAAKIARECGLAARINTVMQMAFFHLTQILPGDSALAELQGAIAKSYSSKGQDLVER
NWQALALARESVEEVPLQPVNPHSANRPPVVSDAAPDFVKTVTAAMLAGLGDALPVSALP
PDGTWPMGTTRWEKRNIAEEIPIWKEELCTQCNHCVAACPHSAIRAKVVPPEAMENAPAS
LHSLDVKSRDMRGQKYVLQVAPEDCTGCNLCVEVCPAKDRQNPEIKAINMMSRLEHVEEE
KINYDFFLNLPEIDRSKLERIDIRTSQLITPLFEYSGACSGCGETPYIKLLTQLYGDRML
IANATGCSSIYGGNLPSTPYTTDANGRGPAWANSLFEDNAEFGLGFRLTVDQHRVRVLRL
LDQFADKIPAELLTALKSDATPEVRREQVAALRQQLNDVAEAHELLRDADALVEKSIWLI
GGDGWAYDIGFGGLDHVLSLTENVNILVLDTQCYSNTGGQASKATPLGAVTKFGEHGKRK
ARKDLGVSMMMYGHVYVAQISLGAQLNQTVKAIQEAEAYPGPSLIIAYSPCEEHGYDLAL
SHDQMRQLTATGFWPLYRFDPRRADEGKLPLALDSRPPSVALEETLLHEQRFRRLNSQQP
EVAEQLWKDAAADLQKRYDFLAQMAGKAEKSNTD
Download sequence
Identical sequences A0A073FZ16 A0A074I5I9 A0A080G1S7 A0A0F3SI40 A0A1S6TAE4 A0A2H8ZDZ3 A7ZLH7 C8U861 D8EF25 F4VDQ9 I2WN65
gi|260843695|ref|YP_003221473.1| WP_000628159.1.100066 WP_000628159.1.100283 WP_000628159.1.100346 WP_000628159.1.100718 WP_000628159.1.100758 WP_000628159.1.100778 WP_000628159.1.100933 WP_000628159.1.101257 WP_000628159.1.101686 WP_000628159.1.10379 WP_000628159.1.10673 WP_000628159.1.1074 WP_000628159.1.11524 WP_000628159.1.11748 WP_000628159.1.12051 WP_000628159.1.12279 WP_000628159.1.1242 WP_000628159.1.12566 WP_000628159.1.12717 WP_000628159.1.12911 WP_000628159.1.13437 WP_000628159.1.13492 WP_000628159.1.14070 WP_000628159.1.14398 WP_000628159.1.14417 WP_000628159.1.14432 WP_000628159.1.14508 WP_000628159.1.14672 WP_000628159.1.14956 WP_000628159.1.14977 WP_000628159.1.14993 WP_000628159.1.15087 WP_000628159.1.15221 WP_000628159.1.15300 WP_000628159.1.15444 WP_000628159.1.15983 WP_000628159.1.16014 WP_000628159.1.16194 WP_000628159.1.1621 WP_000628159.1.16387 WP_000628159.1.1710 WP_000628159.1.17170 WP_000628159.1.17267 WP_000628159.1.17392 WP_000628159.1.17595 WP_000628159.1.1766 WP_000628159.1.17920 WP_000628159.1.17961 WP_000628159.1.18530 WP_000628159.1.18649 WP_000628159.1.18650 WP_000628159.1.188 WP_000628159.1.18899 WP_000628159.1.18923 WP_000628159.1.18983 WP_000628159.1.1909 WP_000628159.1.1925 WP_000628159.1.19389 WP_000628159.1.19397 WP_000628159.1.19778 WP_000628159.1.20129 WP_000628159.1.20519 WP_000628159.1.20662 WP_000628159.1.21336 WP_000628159.1.21596 WP_000628159.1.21628 WP_000628159.1.21656 WP_000628159.1.21948 WP_000628159.1.22269 WP_000628159.1.23290 WP_000628159.1.23376 WP_000628159.1.23486 WP_000628159.1.23640 WP_000628159.1.24136 WP_000628159.1.24641 WP_000628159.1.24650 WP_000628159.1.2479 WP_000628159.1.25086 WP_000628159.1.25414 WP_000628159.1.2543 WP_000628159.1.25548 WP_000628159.1.2558 WP_000628159.1.25755 WP_000628159.1.26055 WP_000628159.1.26479 WP_000628159.1.26569 WP_000628159.1.26598 WP_000628159.1.26720 WP_000628159.1.27524 WP_000628159.1.27723 WP_000628159.1.27876 WP_000628159.1.28480 WP_000628159.1.29055 WP_000628159.1.29118 WP_000628159.1.29150 WP_000628159.1.29503 WP_000628159.1.2954 WP_000628159.1.29590 WP_000628159.1.29683 WP_000628159.1.29840 WP_000628159.1.30428 WP_000628159.1.30742 WP_000628159.1.30906 WP_000628159.1.31860 WP_000628159.1.3193 WP_000628159.1.32138 WP_000628159.1.32184 WP_000628159.1.32406 WP_000628159.1.3248 WP_000628159.1.32709 WP_000628159.1.32875 WP_000628159.1.33119 WP_000628159.1.33475 WP_000628159.1.33667 WP_000628159.1.33745 WP_000628159.1.34206 WP_000628159.1.34781 WP_000628159.1.35376 WP_000628159.1.35934 WP_000628159.1.36070 WP_000628159.1.36507 WP_000628159.1.37371 WP_000628159.1.37773 WP_000628159.1.37852 WP_000628159.1.37880 WP_000628159.1.37887 WP_000628159.1.38120 WP_000628159.1.38257 WP_000628159.1.38777 WP_000628159.1.39302 WP_000628159.1.39305 WP_000628159.1.39780 WP_000628159.1.4020 WP_000628159.1.40403 WP_000628159.1.4049 WP_000628159.1.40563 WP_000628159.1.40686 WP_000628159.1.40781 WP_000628159.1.41147 WP_000628159.1.41263 WP_000628159.1.41287 WP_000628159.1.41371 WP_000628159.1.41402 WP_000628159.1.4142 WP_000628159.1.41654 WP_000628159.1.41712 WP_000628159.1.4172 WP_000628159.1.41780 WP_000628159.1.42060 WP_000628159.1.42415 WP_000628159.1.42480 WP_000628159.1.42962 WP_000628159.1.43239 WP_000628159.1.43363 WP_000628159.1.43455 WP_000628159.1.43474 WP_000628159.1.43642 WP_000628159.1.44075 WP_000628159.1.4473 WP_000628159.1.44857 WP_000628159.1.44961 WP_000628159.1.45600 WP_000628159.1.4570 WP_000628159.1.45865 WP_000628159.1.45930 WP_000628159.1.45968 WP_000628159.1.46027 WP_000628159.1.4613 WP_000628159.1.46197 WP_000628159.1.46301 WP_000628159.1.4646 WP_000628159.1.46999 WP_000628159.1.47398 WP_000628159.1.4796 WP_000628159.1.47962 WP_000628159.1.47976 WP_000628159.1.48000 WP_000628159.1.48018 WP_000628159.1.48222 WP_000628159.1.48291 WP_000628159.1.48421 WP_000628159.1.48615 WP_000628159.1.48921 WP_000628159.1.49190 WP_000628159.1.49481 WP_000628159.1.4949 WP_000628159.1.49861 WP_000628159.1.50113 WP_000628159.1.50207 WP_000628159.1.50412 WP_000628159.1.50616 WP_000628159.1.50725 WP_000628159.1.50996 WP_000628159.1.51013 WP_000628159.1.5128 WP_000628159.1.51405 WP_000628159.1.51427 WP_000628159.1.51580 WP_000628159.1.51629 WP_000628159.1.51985 WP_000628159.1.52171 WP_000628159.1.5239 WP_000628159.1.52662 WP_000628159.1.52710 WP_000628159.1.52762 WP_000628159.1.52881 WP_000628159.1.52962 WP_000628159.1.53364 WP_000628159.1.5362 WP_000628159.1.53642 WP_000628159.1.54072 WP_000628159.1.54317 WP_000628159.1.54359 WP_000628159.1.54591 WP_000628159.1.54638 WP_000628159.1.54688 WP_000628159.1.54708 WP_000628159.1.54725 WP_000628159.1.54729 WP_000628159.1.55041 WP_000628159.1.55115 WP_000628159.1.55144 WP_000628159.1.55197 WP_000628159.1.55338 WP_000628159.1.5616 WP_000628159.1.56216 WP_000628159.1.56231 WP_000628159.1.56399 WP_000628159.1.56439 WP_000628159.1.56704 WP_000628159.1.56721 WP_000628159.1.56871 WP_000628159.1.57072 WP_000628159.1.57086 WP_000628159.1.57216 WP_000628159.1.57222 WP_000628159.1.5748 WP_000628159.1.57487 WP_000628159.1.57638 WP_000628159.1.57920 WP_000628159.1.58146 WP_000628159.1.58206 WP_000628159.1.58289 WP_000628159.1.58528 WP_000628159.1.58705 WP_000628159.1.59174 WP_000628159.1.59199 WP_000628159.1.59302 WP_000628159.1.59413 WP_000628159.1.59699 WP_000628159.1.60698 WP_000628159.1.61174 WP_000628159.1.61636 WP_000628159.1.61939 WP_000628159.1.62041 WP_000628159.1.6212 WP_000628159.1.62447 WP_000628159.1.62850 WP_000628159.1.62973 WP_000628159.1.63393 WP_000628159.1.63470 WP_000628159.1.64150 WP_000628159.1.64438 WP_000628159.1.65305 WP_000628159.1.65306 WP_000628159.1.65493 WP_000628159.1.65708 WP_000628159.1.65762 WP_000628159.1.66001 WP_000628159.1.66181 WP_000628159.1.66412 WP_000628159.1.66644 WP_000628159.1.66926 WP_000628159.1.66948 WP_000628159.1.6735 WP_000628159.1.67522 WP_000628159.1.67581 WP_000628159.1.67701 WP_000628159.1.67724 WP_000628159.1.678 WP_000628159.1.68039 WP_000628159.1.68241 WP_000628159.1.68255 WP_000628159.1.68442 WP_000628159.1.68566 WP_000628159.1.68673 WP_000628159.1.68678 WP_000628159.1.69098 WP_000628159.1.69390 WP_000628159.1.69472 WP_000628159.1.69887 WP_000628159.1.70357 WP_000628159.1.70414 WP_000628159.1.70477 WP_000628159.1.70967 WP_000628159.1.71109 WP_000628159.1.71162 WP_000628159.1.71339 WP_000628159.1.71537 WP_000628159.1.71680 WP_000628159.1.72021 WP_000628159.1.7225 WP_000628159.1.72522 WP_000628159.1.72608 WP_000628159.1.73010 WP_000628159.1.73072 WP_000628159.1.73239 WP_000628159.1.73257 WP_000628159.1.73428 WP_000628159.1.73468 WP_000628159.1.74532 WP_000628159.1.74652 WP_000628159.1.74689 WP_000628159.1.74705 WP_000628159.1.75112 WP_000628159.1.75181 WP_000628159.1.75629 WP_000628159.1.75696 WP_000628159.1.76103 WP_000628159.1.7661 WP_000628159.1.76619 WP_000628159.1.77163 WP_000628159.1.77477 WP_000628159.1.77495 WP_000628159.1.77551 WP_000628159.1.77626 WP_000628159.1.7781 WP_000628159.1.78586 WP_000628159.1.79065 WP_000628159.1.79540 WP_000628159.1.79591 WP_000628159.1.79905 WP_000628159.1.79932 WP_000628159.1.80043 WP_000628159.1.80112 WP_000628159.1.80176 WP_000628159.1.80789 WP_000628159.1.80894 WP_000628159.1.81165 WP_000628159.1.81316 WP_000628159.1.81438 WP_000628159.1.81469 WP_000628159.1.81475 WP_000628159.1.81972 WP_000628159.1.82137 WP_000628159.1.82217 WP_000628159.1.82246 WP_000628159.1.82799 WP_000628159.1.8306 WP_000628159.1.83347 WP_000628159.1.83684 WP_000628159.1.83947 WP_000628159.1.84060 WP_000628159.1.84473 WP_000628159.1.84841 WP_000628159.1.84894 WP_000628159.1.85011 WP_000628159.1.85175 WP_000628159.1.85335 WP_000628159.1.85342 WP_000628159.1.85525 WP_000628159.1.85657 WP_000628159.1.85939 WP_000628159.1.86115 WP_000628159.1.86149 WP_000628159.1.86181 WP_000628159.1.86263 WP_000628159.1.86266 WP_000628159.1.86283 WP_000628159.1.86355 WP_000628159.1.86371 WP_000628159.1.86492 WP_000628159.1.86617 WP_000628159.1.86640 WP_000628159.1.86674 WP_000628159.1.87568 WP_000628159.1.87789 WP_000628159.1.88149 WP_000628159.1.88252 WP_000628159.1.88285 WP_000628159.1.88376 WP_000628159.1.88384 WP_000628159.1.88539 WP_000628159.1.88759 WP_000628159.1.8906 WP_000628159.1.89183 WP_000628159.1.8938 WP_000628159.1.89474 WP_000628159.1.89646 WP_000628159.1.89710 WP_000628159.1.89895 WP_000628159.1.90156 WP_000628159.1.90405 WP_000628159.1.90435 WP_000628159.1.9061 WP_000628159.1.90626 WP_000628159.1.90864 WP_000628159.1.90873 WP_000628159.1.91094 WP_000628159.1.91511 WP_000628159.1.91565 WP_000628159.1.9157 WP_000628159.1.91596 WP_000628159.1.91644 WP_000628159.1.91951 WP_000628159.1.91959 WP_000628159.1.92031 WP_000628159.1.92048 WP_000628159.1.92102 WP_000628159.1.92163 WP_000628159.1.92532 WP_000628159.1.92781 WP_000628159.1.93100 WP_000628159.1.93133 WP_000628159.1.93531 WP_000628159.1.93665 WP_000628159.1.94156 WP_000628159.1.94232 WP_000628159.1.94298 WP_000628159.1.94353 WP_000628159.1.94475 WP_000628159.1.94580 WP_000628159.1.94822 WP_000628159.1.9491 WP_000628159.1.95022 WP_000628159.1.95161 WP_000628159.1.95243 WP_000628159.1.95244 WP_000628159.1.9559 WP_000628159.1.95771 WP_000628159.1.96114 WP_000628159.1.96457 WP_000628159.1.96585 WP_000628159.1.96817 WP_000628159.1.96936 WP_000628159.1.97248 WP_000628159.1.97421 WP_000628159.1.98026 WP_000628159.1.98139 WP_000628159.1.9817 WP_000628159.1.98292 WP_000628159.1.98301 WP_000628159.1.98400 WP_000628159.1.98665 WP_000628159.1.99029 WP_000628159.1.99168 WP_000628159.1.99246 WP_000628159.1.99302 WP_000628159.1.99475 WP_000628159.1.99511 WP_000628159.1.99666 gi|157155711|ref|YP_001462656.1| 331111.EcE24377A_1561 585395.ECO103_1513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]