SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 331111.EcE24377A_2557 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  331111.EcE24377A_2557
Domain Number 1 Region: 104-307
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 8.78e-51
Family D-glucarate dehydratase-like 0.00000000577
Further Details:      
 
Domain Number 2 Region: 1-97
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.5e-30
Family Enolase N-terminal domain-like 0.00000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 331111.EcE24377A_2557
Sequence length 320
Comment (Escherichia coli E24377A)
Sequence
MRSAQVYRWQIPMDAGVVLRDRRLKTRDGLYVCLREGEREGWGEISPLPGFSQETWEEAQ
SVLLAWVNNWLAGDCELPQMPSVAFGVSCALAELADTLPQAANYRAAPLCNGDPDDLILK
LADMPGEKVAKVKVGLYEAVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKGQQFAKYVNP
DYRHRIAFLEEPCKTRDDSRAFARETGIAIAWDESLREPDFAFVAEEGVRAVVIKPTLTG
SLEKVREQVQAAHALGLTAVISSSIESSLGLTQLARIAAWLTPDTIPGLDTLDLMQAQQV
RRWPGSTLPVVEVDALERLL
Download sequence
Identical sequences A0A026UL15 A0A027U7A0 A0A028AR03 A0A028E6I6 A0A070FH29 A0A073G5U2 A0A074HYS3 A0A080FU16 A0A0A8UAS2 A0A0E0XWX1 A0A0E2TRU7 A0A1H0C2B0 A0A1S6TE57 A0A1X3L1C5 A0A222QMM9 A7ZP80 B6I7K5 B7LAS7 B7M5U4 C8U6J0 C8UDL6 D7Y456 D8E671 E9T9G3 F4NDP7 I2S156 I2UMR1 I2WIM7 I2WN30 I4SZL7 K4W3J2 K4WZA7 S1DF19 U9Y6Q1 V6FVC7 V8FGG6 W8T7W3
gi|260868987|ref|YP_003235389.1| gi|218554821|ref|YP_002387734.1| gi|407470145|ref|YP_006783412.1| gi|407481192|ref|YP_006778341.1| WP_001255609.1.1000 WP_001255609.1.100066 WP_001255609.1.100252 WP_001255609.1.100283 WP_001255609.1.100346 WP_001255609.1.100425 WP_001255609.1.100499 WP_001255609.1.100543 WP_001255609.1.100573 WP_001255609.1.100667 WP_001255609.1.10068 WP_001255609.1.100689 WP_001255609.1.100718 WP_001255609.1.100752 WP_001255609.1.100778 WP_001255609.1.100796 WP_001255609.1.10080 WP_001255609.1.100836 WP_001255609.1.100867 WP_001255609.1.100928 WP_001255609.1.100933 WP_001255609.1.101096 WP_001255609.1.101102 WP_001255609.1.101157 WP_001255609.1.101257 WP_001255609.1.10126 WP_001255609.1.101359 WP_001255609.1.101418 WP_001255609.1.101436 WP_001255609.1.101468 WP_001255609.1.101518 WP_001255609.1.10154 WP_001255609.1.101630 WP_001255609.1.101651 WP_001255609.1.101653 WP_001255609.1.101668 WP_001255609.1.101686 WP_001255609.1.101786 WP_001255609.1.101840 WP_001255609.1.101845 WP_001255609.1.101865 WP_001255609.1.10190 WP_001255609.1.101913 WP_001255609.1.101947 WP_001255609.1.101952 WP_001255609.1.101964 WP_001255609.1.101969 WP_001255609.1.101987 WP_001255609.1.102069 WP_001255609.1.102122 WP_001255609.1.10379 WP_001255609.1.10461 WP_001255609.1.10538 WP_001255609.1.10579 WP_001255609.1.10607 WP_001255609.1.10651 WP_001255609.1.10673 WP_001255609.1.1073 WP_001255609.1.1074 WP_001255609.1.10763 WP_001255609.1.10940 WP_001255609.1.10994 WP_001255609.1.11091 WP_001255609.1.11118 WP_001255609.1.11133 WP_001255609.1.1122 WP_001255609.1.11524 WP_001255609.1.11616 WP_001255609.1.11645 WP_001255609.1.11748 WP_001255609.1.11759 WP_001255609.1.11801 WP_001255609.1.11949 WP_001255609.1.11985 WP_001255609.1.12036 WP_001255609.1.12051 WP_001255609.1.12279 WP_001255609.1.12344 WP_001255609.1.1242 WP_001255609.1.12566 WP_001255609.1.12623 WP_001255609.1.12645 WP_001255609.1.12693 WP_001255609.1.12717 WP_001255609.1.12743 WP_001255609.1.12781 WP_001255609.1.1295 WP_001255609.1.12979 WP_001255609.1.1315 WP_001255609.1.13162 WP_001255609.1.13222 WP_001255609.1.13301 WP_001255609.1.13437 WP_001255609.1.13451 WP_001255609.1.13656 WP_001255609.1.13791 WP_001255609.1.13944 WP_001255609.1.14058 WP_001255609.1.14062 WP_001255609.1.14070 WP_001255609.1.14304 WP_001255609.1.1439 WP_001255609.1.14398 WP_001255609.1.14417 WP_001255609.1.14432 WP_001255609.1.14493 WP_001255609.1.14508 WP_001255609.1.14582 WP_001255609.1.14672 WP_001255609.1.14693 WP_001255609.1.1470 WP_001255609.1.14956 WP_001255609.1.14993 WP_001255609.1.15041 WP_001255609.1.15087 WP_001255609.1.1510 WP_001255609.1.15138 WP_001255609.1.15193 WP_001255609.1.15207 WP_001255609.1.15221 WP_001255609.1.1524 WP_001255609.1.15270 WP_001255609.1.15277 WP_001255609.1.15300 WP_001255609.1.15335 WP_001255609.1.15377 WP_001255609.1.1543 WP_001255609.1.15444 WP_001255609.1.15464 WP_001255609.1.15521 WP_001255609.1.15528 WP_001255609.1.15538 WP_001255609.1.15583 WP_001255609.1.15593 WP_001255609.1.1561 WP_001255609.1.15707 WP_001255609.1.15752 WP_001255609.1.15767 WP_001255609.1.15791 WP_001255609.1.15809 WP_001255609.1.1582 WP_001255609.1.15916 WP_001255609.1.15983 WP_001255609.1.16014 WP_001255609.1.16183 WP_001255609.1.16194 WP_001255609.1.1621 WP_001255609.1.16388 WP_001255609.1.1640 WP_001255609.1.16517 WP_001255609.1.16539 WP_001255609.1.16592 WP_001255609.1.16682 WP_001255609.1.1673 WP_001255609.1.16745 WP_001255609.1.16861 WP_001255609.1.17102 WP_001255609.1.17111 WP_001255609.1.17170 WP_001255609.1.17172 WP_001255609.1.17182 WP_001255609.1.17241 WP_001255609.1.17267 WP_001255609.1.17373 WP_001255609.1.17392 WP_001255609.1.17403 WP_001255609.1.17410 WP_001255609.1.17417 WP_001255609.1.17464 WP_001255609.1.1754 WP_001255609.1.17550 WP_001255609.1.17595 WP_001255609.1.17623 WP_001255609.1.17637 WP_001255609.1.1766 WP_001255609.1.1769 WP_001255609.1.17766 WP_001255609.1.17920 WP_001255609.1.17961 WP_001255609.1.17963 WP_001255609.1.17984 WP_001255609.1.18000 WP_001255609.1.18064 WP_001255609.1.18164 WP_001255609.1.18338 WP_001255609.1.18436 WP_001255609.1.18438 WP_001255609.1.1844 WP_001255609.1.18519 WP_001255609.1.18530 WP_001255609.1.18650 WP_001255609.1.18666 WP_001255609.1.18714 WP_001255609.1.188 WP_001255609.1.18861 WP_001255609.1.18874 WP_001255609.1.18899 WP_001255609.1.18929 WP_001255609.1.18983 WP_001255609.1.1906 WP_001255609.1.1909 WP_001255609.1.19090 WP_001255609.1.19147 WP_001255609.1.19297 WP_001255609.1.19312 WP_001255609.1.19332 WP_001255609.1.19389 WP_001255609.1.19397 WP_001255609.1.19424 WP_001255609.1.19494 WP_001255609.1.19544 WP_001255609.1.19557 WP_001255609.1.19581 WP_001255609.1.19583 WP_001255609.1.19655 WP_001255609.1.19778 WP_001255609.1.20114 WP_001255609.1.20129 WP_001255609.1.20157 WP_001255609.1.20159 WP_001255609.1.20215 WP_001255609.1.20334 WP_001255609.1.20483 WP_001255609.1.20519 WP_001255609.1.20549 WP_001255609.1.20630 WP_001255609.1.20662 WP_001255609.1.20730 WP_001255609.1.20848 WP_001255609.1.21041 WP_001255609.1.21104 WP_001255609.1.21137 WP_001255609.1.21248 WP_001255609.1.21336 WP_001255609.1.21441 WP_001255609.1.21519 WP_001255609.1.21667 WP_001255609.1.21732 WP_001255609.1.21812 WP_001255609.1.21887 WP_001255609.1.21945 WP_001255609.1.21948 WP_001255609.1.22204 WP_001255609.1.22269 WP_001255609.1.22291 WP_001255609.1.22350 WP_001255609.1.22494 WP_001255609.1.22544 WP_001255609.1.22685 WP_001255609.1.22777 WP_001255609.1.22868 WP_001255609.1.22908 WP_001255609.1.23005 WP_001255609.1.23078 WP_001255609.1.23383 WP_001255609.1.23388 WP_001255609.1.23393 WP_001255609.1.23487 WP_001255609.1.23520 WP_001255609.1.23527 WP_001255609.1.23593 WP_001255609.1.23693 WP_001255609.1.23741 WP_001255609.1.23754 WP_001255609.1.23970 WP_001255609.1.24024 WP_001255609.1.24136 WP_001255609.1.24233 WP_001255609.1.24278 WP_001255609.1.24460 WP_001255609.1.24473 WP_001255609.1.24483 WP_001255609.1.24485 WP_001255609.1.24536 WP_001255609.1.24575 WP_001255609.1.24641 WP_001255609.1.24642 WP_001255609.1.24646 WP_001255609.1.24650 WP_001255609.1.24695 WP_001255609.1.2479 WP_001255609.1.24849 WP_001255609.1.24939 WP_001255609.1.24984 WP_001255609.1.25019 WP_001255609.1.25050 WP_001255609.1.25378 WP_001255609.1.25414 WP_001255609.1.2543 WP_001255609.1.25548 WP_001255609.1.2558 WP_001255609.1.25592 WP_001255609.1.25613 WP_001255609.1.2588 WP_001255609.1.25886 WP_001255609.1.25945 WP_001255609.1.26055 WP_001255609.1.26061 WP_001255609.1.26100 WP_001255609.1.26130 WP_001255609.1.26161 WP_001255609.1.26186 WP_001255609.1.26191 WP_001255609.1.26270 WP_001255609.1.26325 WP_001255609.1.26331 WP_001255609.1.26391 WP_001255609.1.2642 WP_001255609.1.26479 WP_001255609.1.26517 WP_001255609.1.26598 WP_001255609.1.26613 WP_001255609.1.26683 WP_001255609.1.26720 WP_001255609.1.26736 WP_001255609.1.26912 WP_001255609.1.27019 WP_001255609.1.27060 WP_001255609.1.27148 WP_001255609.1.27234 WP_001255609.1.27287 WP_001255609.1.2731 WP_001255609.1.27424 WP_001255609.1.27524 WP_001255609.1.27580 WP_001255609.1.27691 WP_001255609.1.27723 WP_001255609.1.27749 WP_001255609.1.27758 WP_001255609.1.27856 WP_001255609.1.27876 WP_001255609.1.27897 WP_001255609.1.28109 WP_001255609.1.2823 WP_001255609.1.28250 WP_001255609.1.28305 WP_001255609.1.28480 WP_001255609.1.28523 WP_001255609.1.28540 WP_001255609.1.28683 WP_001255609.1.2881 WP_001255609.1.29082 WP_001255609.1.29118 WP_001255609.1.29125 WP_001255609.1.29202 WP_001255609.1.29206 WP_001255609.1.29503 WP_001255609.1.29504 WP_001255609.1.2952 WP_001255609.1.2954 WP_001255609.1.29590 WP_001255609.1.29669 WP_001255609.1.29715 WP_001255609.1.29724 WP_001255609.1.29798 WP_001255609.1.29812 WP_001255609.1.29840 WP_001255609.1.29874 WP_001255609.1.29876 WP_001255609.1.30035 WP_001255609.1.30105 WP_001255609.1.30123 WP_001255609.1.30391 WP_001255609.1.30452 WP_001255609.1.30733 WP_001255609.1.30853 WP_001255609.1.30906 WP_001255609.1.31009 WP_001255609.1.31319 WP_001255609.1.31340 WP_001255609.1.31347 WP_001255609.1.31357 WP_001255609.1.31419 WP_001255609.1.31429 WP_001255609.1.31518 WP_001255609.1.31521 WP_001255609.1.31618 WP_001255609.1.31803 WP_001255609.1.31860 WP_001255609.1.31866 WP_001255609.1.31924 WP_001255609.1.3193 WP_001255609.1.32089 WP_001255609.1.32091 WP_001255609.1.32138 WP_001255609.1.32142 WP_001255609.1.32184 WP_001255609.1.32234 WP_001255609.1.32236 WP_001255609.1.32287 WP_001255609.1.32406 WP_001255609.1.32443 WP_001255609.1.3247 WP_001255609.1.32475 WP_001255609.1.3248 WP_001255609.1.32494 WP_001255609.1.32561 WP_001255609.1.32709 WP_001255609.1.32724 WP_001255609.1.32831 WP_001255609.1.32875 WP_001255609.1.32946 WP_001255609.1.32959 WP_001255609.1.32972 WP_001255609.1.32995 WP_001255609.1.33004 WP_001255609.1.33014 WP_001255609.1.33018 WP_001255609.1.33341 WP_001255609.1.33385 WP_001255609.1.33475 WP_001255609.1.33631 WP_001255609.1.33638 WP_001255609.1.33680 WP_001255609.1.33745 WP_001255609.1.34094 WP_001255609.1.34206 WP_001255609.1.34273 WP_001255609.1.34341 WP_001255609.1.34397 WP_001255609.1.3444 WP_001255609.1.34781 WP_001255609.1.34855 WP_001255609.1.35006 WP_001255609.1.35114 WP_001255609.1.35202 WP_001255609.1.35316 WP_001255609.1.3539 WP_001255609.1.35464 WP_001255609.1.35465 WP_001255609.1.35552 WP_001255609.1.35604 WP_001255609.1.35653 WP_001255609.1.35922 WP_001255609.1.35927 WP_001255609.1.35934 WP_001255609.1.35942 WP_001255609.1.36042 WP_001255609.1.36070 WP_001255609.1.36085 WP_001255609.1.36094 WP_001255609.1.36166 WP_001255609.1.36177 WP_001255609.1.36412 WP_001255609.1.36500 WP_001255609.1.36507 WP_001255609.1.36610 WP_001255609.1.36628 WP_001255609.1.36707 WP_001255609.1.36806 WP_001255609.1.36812 WP_001255609.1.36975 WP_001255609.1.37046 WP_001255609.1.37099 WP_001255609.1.37206 WP_001255609.1.37352 WP_001255609.1.37371 WP_001255609.1.37510 WP_001255609.1.37538 WP_001255609.1.37554 WP_001255609.1.377 WP_001255609.1.3772 WP_001255609.1.37758 WP_001255609.1.37762 WP_001255609.1.37773 WP_001255609.1.37852 WP_001255609.1.37880 WP_001255609.1.37887 WP_001255609.1.37917 WP_001255609.1.37926 WP_001255609.1.37995 WP_001255609.1.38081 WP_001255609.1.38103 WP_001255609.1.38120 WP_001255609.1.38162 WP_001255609.1.3822 WP_001255609.1.38257 WP_001255609.1.38357 WP_001255609.1.38412 WP_001255609.1.38626 WP_001255609.1.38629 WP_001255609.1.3873 WP_001255609.1.38777 WP_001255609.1.38782 WP_001255609.1.38911 WP_001255609.1.38935 WP_001255609.1.39005 WP_001255609.1.39037 WP_001255609.1.39042 WP_001255609.1.39103 WP_001255609.1.39123 WP_001255609.1.39150 WP_001255609.1.39171 WP_001255609.1.39302 WP_001255609.1.39305 WP_001255609.1.39481 WP_001255609.1.39509 WP_001255609.1.39607 WP_001255609.1.39610 WP_001255609.1.39690 WP_001255609.1.39758 WP_001255609.1.39780 WP_001255609.1.39818 WP_001255609.1.40016 WP_001255609.1.4020 WP_001255609.1.40206 WP_001255609.1.40249 WP_001255609.1.40315 WP_001255609.1.40382 WP_001255609.1.40403 WP_001255609.1.4049 WP_001255609.1.40509 WP_001255609.1.40596 WP_001255609.1.40666 WP_001255609.1.40686 WP_001255609.1.40781 WP_001255609.1.40813 WP_001255609.1.40865 WP_001255609.1.41037 WP_001255609.1.41125 WP_001255609.1.41147 WP_001255609.1.41239 WP_001255609.1.41263 WP_001255609.1.41287 WP_001255609.1.41315 WP_001255609.1.41371 WP_001255609.1.41392 WP_001255609.1.41402 WP_001255609.1.4142 WP_001255609.1.41455 WP_001255609.1.41466 WP_001255609.1.41479 WP_001255609.1.41545 WP_001255609.1.41566 WP_001255609.1.41613 WP_001255609.1.41712 WP_001255609.1.4172 WP_001255609.1.41740 WP_001255609.1.41752 WP_001255609.1.41780 WP_001255609.1.41964 WP_001255609.1.41988 WP_001255609.1.42038 WP_001255609.1.42060 WP_001255609.1.42138 WP_001255609.1.4214 WP_001255609.1.42203 WP_001255609.1.4224 WP_001255609.1.42252 WP_001255609.1.42387 WP_001255609.1.42415 WP_001255609.1.42442 WP_001255609.1.42456 WP_001255609.1.42480 WP_001255609.1.42669 WP_001255609.1.42748 WP_001255609.1.42813 WP_001255609.1.42832 WP_001255609.1.42950 WP_001255609.1.42962 WP_001255609.1.43132 WP_001255609.1.43137 WP_001255609.1.43166 WP_001255609.1.43177 WP_001255609.1.43239 WP_001255609.1.43316 WP_001255609.1.43363 WP_001255609.1.4342 WP_001255609.1.43455 WP_001255609.1.43474 WP_001255609.1.43598 WP_001255609.1.43642 WP_001255609.1.43769 WP_001255609.1.44018 WP_001255609.1.44029 WP_001255609.1.44040 WP_001255609.1.44077 WP_001255609.1.4415 WP_001255609.1.44273 WP_001255609.1.44285 WP_001255609.1.44445 WP_001255609.1.44461 WP_001255609.1.4449 WP_001255609.1.44524 WP_001255609.1.44661 WP_001255609.1.4473 WP_001255609.1.44857 WP_001255609.1.44961 WP_001255609.1.45053 WP_001255609.1.45444 WP_001255609.1.45600 WP_001255609.1.45840 WP_001255609.1.45846 WP_001255609.1.45865 WP_001255609.1.45868 WP_001255609.1.45930 WP_001255609.1.45960 WP_001255609.1.45968 WP_001255609.1.4600 WP_001255609.1.46027 WP_001255609.1.46048 WP_001255609.1.46049 WP_001255609.1.46070 WP_001255609.1.46105 WP_001255609.1.46197 WP_001255609.1.46433 WP_001255609.1.4646 WP_001255609.1.46477 WP_001255609.1.46526 WP_001255609.1.46552 WP_001255609.1.46555 WP_001255609.1.4657 WP_001255609.1.46602 WP_001255609.1.46614 WP_001255609.1.46616 WP_001255609.1.46643 WP_001255609.1.46668 WP_001255609.1.46743 WP_001255609.1.46821 WP_001255609.1.46876 WP_001255609.1.4691 WP_001255609.1.46999 WP_001255609.1.47029 WP_001255609.1.47034 WP_001255609.1.47050 WP_001255609.1.47063 WP_001255609.1.47069 WP_001255609.1.47246 WP_001255609.1.47332 WP_001255609.1.47363 WP_001255609.1.47398 WP_001255609.1.4740 WP_001255609.1.47425 WP_001255609.1.47473 WP_001255609.1.47555 WP_001255609.1.47662 WP_001255609.1.47820 WP_001255609.1.4785 WP_001255609.1.4796 WP_001255609.1.47976 WP_001255609.1.48000 WP_001255609.1.48018 WP_001255609.1.48077 WP_001255609.1.48144 WP_001255609.1.48188 WP_001255609.1.48222 WP_001255609.1.48291 WP_001255609.1.48385 WP_001255609.1.48421 WP_001255609.1.48433 WP_001255609.1.4857 WP_001255609.1.48571 WP_001255609.1.48615 WP_001255609.1.48678 WP_001255609.1.48771 WP_001255609.1.48801 WP_001255609.1.48921 WP_001255609.1.48926 WP_001255609.1.48954 WP_001255609.1.49107 WP_001255609.1.49124 WP_001255609.1.49147 WP_001255609.1.49190 WP_001255609.1.49229 WP_001255609.1.49243 WP_001255609.1.49312 WP_001255609.1.49336 WP_001255609.1.49459 WP_001255609.1.49481 WP_001255609.1.4949 WP_001255609.1.49546 WP_001255609.1.49558 WP_001255609.1.49712 WP_001255609.1.49722 WP_001255609.1.49774 WP_001255609.1.49856 WP_001255609.1.49861 WP_001255609.1.49879 WP_001255609.1.49950 WP_001255609.1.49954 WP_001255609.1.49987 WP_001255609.1.50113 WP_001255609.1.50119 WP_001255609.1.50182 WP_001255609.1.50207 WP_001255609.1.50258 WP_001255609.1.50366 WP_001255609.1.50418 WP_001255609.1.50586 WP_001255609.1.50616 WP_001255609.1.5064 WP_001255609.1.50725 WP_001255609.1.50939 WP_001255609.1.50969 WP_001255609.1.50996 WP_001255609.1.51013 WP_001255609.1.51058 WP_001255609.1.51175 WP_001255609.1.51260 WP_001255609.1.51278 WP_001255609.1.51299 WP_001255609.1.51323 WP_001255609.1.51405 WP_001255609.1.51427 WP_001255609.1.51462 WP_001255609.1.51490 WP_001255609.1.51525 WP_001255609.1.51537 WP_001255609.1.51580 WP_001255609.1.51629 WP_001255609.1.51707 WP_001255609.1.51718 WP_001255609.1.51837 WP_001255609.1.51985 WP_001255609.1.51999 WP_001255609.1.52171 WP_001255609.1.5227 WP_001255609.1.52272 WP_001255609.1.52612 WP_001255609.1.52662 WP_001255609.1.52691 WP_001255609.1.52710 WP_001255609.1.52735 WP_001255609.1.52777 WP_001255609.1.52852 WP_001255609.1.52881 WP_001255609.1.52908 WP_001255609.1.52913 WP_001255609.1.52962 WP_001255609.1.52995 WP_001255609.1.53027 WP_001255609.1.53065 WP_001255609.1.5310 WP_001255609.1.532 WP_001255609.1.5322 WP_001255609.1.53242 WP_001255609.1.53251 WP_001255609.1.53262 WP_001255609.1.53356 WP_001255609.1.53364 WP_001255609.1.53401 WP_001255609.1.5342 WP_001255609.1.53537 WP_001255609.1.5362 WP_001255609.1.53642 WP_001255609.1.53706 WP_001255609.1.53841 WP_001255609.1.53863 WP_001255609.1.53866 WP_001255609.1.53978 WP_001255609.1.54023 WP_001255609.1.54072 WP_001255609.1.54091 WP_001255609.1.54202 WP_001255609.1.54307 WP_001255609.1.54317 WP_001255609.1.54546 WP_001255609.1.54591 WP_001255609.1.5460 WP_001255609.1.54638 WP_001255609.1.54688 WP_001255609.1.54695 WP_001255609.1.54708 WP_001255609.1.54725 WP_001255609.1.54729 WP_001255609.1.54798 WP_001255609.1.54817 WP_001255609.1.54829 WP_001255609.1.54918 WP_001255609.1.55009 WP_001255609.1.55115 WP_001255609.1.55144 WP_001255609.1.55197 WP_001255609.1.5520 WP_001255609.1.55291 WP_001255609.1.55338 WP_001255609.1.55342 WP_001255609.1.55357 WP_001255609.1.55417 WP_001255609.1.55597 WP_001255609.1.5561 WP_001255609.1.5570 WP_001255609.1.55709 WP_001255609.1.55787 WP_001255609.1.55844 WP_001255609.1.55988 WP_001255609.1.56149 WP_001255609.1.5616 WP_001255609.1.56193 WP_001255609.1.56216 WP_001255609.1.56231 WP_001255609.1.56302 WP_001255609.1.56371 WP_001255609.1.56390 WP_001255609.1.56399 WP_001255609.1.56439 WP_001255609.1.5646 WP_001255609.1.56543 WP_001255609.1.56680 WP_001255609.1.56689 WP_001255609.1.5670 WP_001255609.1.56704 WP_001255609.1.56721 WP_001255609.1.56742 WP_001255609.1.56799 WP_001255609.1.56835 WP_001255609.1.5685 WP_001255609.1.57072 WP_001255609.1.57086 WP_001255609.1.57100 WP_001255609.1.57222 WP_001255609.1.57281 WP_001255609.1.5748 WP_001255609.1.57487 WP_001255609.1.5755 WP_001255609.1.57629 WP_001255609.1.57638 WP_001255609.1.57812 WP_001255609.1.57920 WP_001255609.1.58001 WP_001255609.1.58022 WP_001255609.1.58143 WP_001255609.1.58146 WP_001255609.1.58226 WP_001255609.1.58289 WP_001255609.1.58371 WP_001255609.1.58408 WP_001255609.1.58445 WP_001255609.1.58507 WP_001255609.1.58514 WP_001255609.1.58528 WP_001255609.1.58547 WP_001255609.1.58572 WP_001255609.1.58582 WP_001255609.1.58705 WP_001255609.1.58977 WP_001255609.1.58983 WP_001255609.1.59083 WP_001255609.1.59119 WP_001255609.1.59174 WP_001255609.1.59190 WP_001255609.1.59199 WP_001255609.1.59293 WP_001255609.1.59409 WP_001255609.1.59413 WP_001255609.1.59434 WP_001255609.1.59621 WP_001255609.1.59638 WP_001255609.1.59699 WP_001255609.1.59717 WP_001255609.1.59782 WP_001255609.1.59836 WP_001255609.1.60070 WP_001255609.1.60325 WP_001255609.1.60387 WP_001255609.1.60491 WP_001255609.1.6059 WP_001255609.1.60606 WP_001255609.1.6064 WP_001255609.1.60698 WP_001255609.1.60732 WP_001255609.1.60835 WP_001255609.1.61035 WP_001255609.1.61058 WP_001255609.1.6110 WP_001255609.1.61112 WP_001255609.1.61174 WP_001255609.1.61225 WP_001255609.1.61292 WP_001255609.1.61758 WP_001255609.1.61806 WP_001255609.1.61939 WP_001255609.1.61948 WP_001255609.1.61957 WP_001255609.1.62041 WP_001255609.1.62273 WP_001255609.1.62337 WP_001255609.1.62358 WP_001255609.1.62447 WP_001255609.1.62514 WP_001255609.1.62529 WP_001255609.1.62646 WP_001255609.1.62681 WP_001255609.1.62714 WP_001255609.1.62762 WP_001255609.1.62769 WP_001255609.1.62850 WP_001255609.1.62851 WP_001255609.1.62914 WP_001255609.1.62931 WP_001255609.1.62959 WP_001255609.1.62973 WP_001255609.1.6299 WP_001255609.1.63177 WP_001255609.1.63374 WP_001255609.1.63437 WP_001255609.1.63466 WP_001255609.1.63467 WP_001255609.1.63470 WP_001255609.1.63484 WP_001255609.1.63536 WP_001255609.1.63556 WP_001255609.1.63576 WP_001255609.1.63666 WP_001255609.1.63679 WP_001255609.1.63821 WP_001255609.1.64008 WP_001255609.1.64014 WP_001255609.1.64050 WP_001255609.1.64074 WP_001255609.1.64150 WP_001255609.1.64175 WP_001255609.1.64286 WP_001255609.1.64355 WP_001255609.1.64356 WP_001255609.1.64380 WP_001255609.1.6441 WP_001255609.1.64528 WP_001255609.1.64707 WP_001255609.1.64926 WP_001255609.1.65023 WP_001255609.1.65151 WP_001255609.1.65179 WP_001255609.1.65305 WP_001255609.1.65306 WP_001255609.1.654 WP_001255609.1.65581 WP_001255609.1.65708 WP_001255609.1.65962 WP_001255609.1.6599 WP_001255609.1.66001 WP_001255609.1.66007 WP_001255609.1.66094 WP_001255609.1.66181 WP_001255609.1.66288 WP_001255609.1.66412 WP_001255609.1.6645 WP_001255609.1.6676 WP_001255609.1.66783 WP_001255609.1.66926 WP_001255609.1.67018 WP_001255609.1.67026 WP_001255609.1.67102 WP_001255609.1.67116 WP_001255609.1.67194 WP_001255609.1.67209 WP_001255609.1.6723 WP_001255609.1.6735 WP_001255609.1.67383 WP_001255609.1.67522 WP_001255609.1.67581 WP_001255609.1.67701 WP_001255609.1.67724 WP_001255609.1.678 WP_001255609.1.67841 WP_001255609.1.68011 WP_001255609.1.68175 WP_001255609.1.682 WP_001255609.1.68241 WP_001255609.1.68255 WP_001255609.1.68278 WP_001255609.1.68300 WP_001255609.1.68347 WP_001255609.1.68442 WP_001255609.1.6860 WP_001255609.1.68609 WP_001255609.1.68673 WP_001255609.1.68678 WP_001255609.1.68695 WP_001255609.1.68915 WP_001255609.1.68956 WP_001255609.1.69098 WP_001255609.1.69126 WP_001255609.1.69390 WP_001255609.1.69472 WP_001255609.1.69589 WP_001255609.1.69649 WP_001255609.1.69689 WP_001255609.1.69786 WP_001255609.1.69887 WP_001255609.1.70213 WP_001255609.1.70357 WP_001255609.1.70414 WP_001255609.1.70477 WP_001255609.1.7052 WP_001255609.1.70592 WP_001255609.1.70628 WP_001255609.1.70745 WP_001255609.1.70748 WP_001255609.1.70801 WP_001255609.1.70803 WP_001255609.1.70967 WP_001255609.1.71062 WP_001255609.1.71109 WP_001255609.1.71113 WP_001255609.1.71134 WP_001255609.1.71147 WP_001255609.1.71162 WP_001255609.1.71275 WP_001255609.1.71339 WP_001255609.1.71354 WP_001255609.1.71533 WP_001255609.1.71537 WP_001255609.1.71680 WP_001255609.1.71757 WP_001255609.1.71874 WP_001255609.1.71987 WP_001255609.1.72013 WP_001255609.1.72090 WP_001255609.1.72125 WP_001255609.1.72240 WP_001255609.1.7225 WP_001255609.1.72270 WP_001255609.1.72493 WP_001255609.1.72522 WP_001255609.1.72608 WP_001255609.1.72695 WP_001255609.1.72725 WP_001255609.1.72729 WP_001255609.1.72751 WP_001255609.1.72764 WP_001255609.1.7277 WP_001255609.1.72837 WP_001255609.1.72858 WP_001255609.1.73010 WP_001255609.1.73032 WP_001255609.1.73072 WP_001255609.1.73075 WP_001255609.1.73197 WP_001255609.1.73239 WP_001255609.1.73249 WP_001255609.1.73251 WP_001255609.1.73257 WP_001255609.1.73259 WP_001255609.1.73326 WP_001255609.1.73349 WP_001255609.1.73428 WP_001255609.1.73468 WP_001255609.1.73663 WP_001255609.1.73700 WP_001255609.1.73709 WP_001255609.1.73797 WP_001255609.1.73897 WP_001255609.1.73908 WP_001255609.1.73995 WP_001255609.1.73996 WP_001255609.1.7413 WP_001255609.1.74156 WP_001255609.1.74431 WP_001255609.1.74491 WP_001255609.1.74501 WP_001255609.1.74532 WP_001255609.1.74624 WP_001255609.1.74670 WP_001255609.1.74687 WP_001255609.1.74689 WP_001255609.1.74735 WP_001255609.1.74752 WP_001255609.1.7478 WP_001255609.1.74852 WP_001255609.1.74885 WP_001255609.1.74889 WP_001255609.1.74895 WP_001255609.1.75021 WP_001255609.1.75029 WP_001255609.1.75050 WP_001255609.1.75112 WP_001255609.1.75270 WP_001255609.1.75272 WP_001255609.1.75360 WP_001255609.1.75435 WP_001255609.1.75465 WP_001255609.1.75588 WP_001255609.1.75629 WP_001255609.1.75676 WP_001255609.1.75696 WP_001255609.1.75973 WP_001255609.1.75999 WP_001255609.1.76005 WP_001255609.1.7603 WP_001255609.1.76036 WP_001255609.1.76103 WP_001255609.1.76129 WP_001255609.1.76325 WP_001255609.1.76384 WP_001255609.1.76390 WP_001255609.1.76542 WP_001255609.1.76595 WP_001255609.1.7661 WP_001255609.1.76619 WP_001255609.1.76656 WP_001255609.1.76966 WP_001255609.1.7699 WP_001255609.1.77015 WP_001255609.1.77070 WP_001255609.1.77109 WP_001255609.1.77162 WP_001255609.1.77163 WP_001255609.1.77255 WP_001255609.1.77258 WP_001255609.1.77341 WP_001255609.1.77437 WP_001255609.1.77462 WP_001255609.1.77477 WP_001255609.1.77495 WP_001255609.1.77551 WP_001255609.1.77581 WP_001255609.1.77608 WP_001255609.1.77626 WP_001255609.1.77767 WP_001255609.1.7781 WP_001255609.1.77826 WP_001255609.1.77833 WP_001255609.1.77929 WP_001255609.1.77949 WP_001255609.1.77999 WP_001255609.1.78099 WP_001255609.1.78337 WP_001255609.1.78445 WP_001255609.1.78462 WP_001255609.1.78586 WP_001255609.1.78687 WP_001255609.1.78698 WP_001255609.1.78757 WP_001255609.1.78775 WP_001255609.1.78843 WP_001255609.1.78888 WP_001255609.1.78891 WP_001255609.1.78919 WP_001255609.1.78966 WP_001255609.1.7898 WP_001255609.1.7901 WP_001255609.1.79065 WP_001255609.1.79067 WP_001255609.1.79389 WP_001255609.1.79391 WP_001255609.1.79519 WP_001255609.1.79591 WP_001255609.1.79713 WP_001255609.1.79800 WP_001255609.1.79824 WP_001255609.1.80043 WP_001255609.1.8007 WP_001255609.1.80071 WP_001255609.1.80106 WP_001255609.1.80112 WP_001255609.1.80141 WP_001255609.1.80176 WP_001255609.1.80310 WP_001255609.1.80709 WP_001255609.1.80737 WP_001255609.1.8076 WP_001255609.1.80894 WP_001255609.1.80946 WP_001255609.1.80983 WP_001255609.1.80985 WP_001255609.1.810 WP_001255609.1.81026 WP_001255609.1.81036 WP_001255609.1.811 WP_001255609.1.81165 WP_001255609.1.81316 WP_001255609.1.81376 WP_001255609.1.81438 WP_001255609.1.81475 WP_001255609.1.81517 WP_001255609.1.81580 WP_001255609.1.81596 WP_001255609.1.81625 WP_001255609.1.81869 WP_001255609.1.81972 WP_001255609.1.82 WP_001255609.1.82062 WP_001255609.1.82137 WP_001255609.1.82217 WP_001255609.1.82239 WP_001255609.1.82242 WP_001255609.1.82246 WP_001255609.1.82326 WP_001255609.1.82378 WP_001255609.1.82485 WP_001255609.1.82572 WP_001255609.1.82718 WP_001255609.1.8277 WP_001255609.1.82799 WP_001255609.1.83035 WP_001255609.1.8306 WP_001255609.1.83564 WP_001255609.1.83684 WP_001255609.1.83807 WP_001255609.1.83947 WP_001255609.1.84060 WP_001255609.1.84140 WP_001255609.1.84348 WP_001255609.1.84436 WP_001255609.1.84467 WP_001255609.1.84473 WP_001255609.1.84484 WP_001255609.1.84511 WP_001255609.1.84656 WP_001255609.1.8470 WP_001255609.1.84784 WP_001255609.1.84881 WP_001255609.1.84893 WP_001255609.1.84894 WP_001255609.1.84941 WP_001255609.1.85011 WP_001255609.1.85085 WP_001255609.1.85105 WP_001255609.1.85175 WP_001255609.1.85335 WP_001255609.1.85342 WP_001255609.1.85525 WP_001255609.1.85657 WP_001255609.1.85762 WP_001255609.1.85944 WP_001255609.1.86035 WP_001255609.1.8607 WP_001255609.1.86115 WP_001255609.1.86149 WP_001255609.1.86181 WP_001255609.1.86210 WP_001255609.1.86263 WP_001255609.1.86266 WP_001255609.1.86276 WP_001255609.1.86283 WP_001255609.1.86355 WP_001255609.1.86364 WP_001255609.1.86371 WP_001255609.1.86376 WP_001255609.1.86393 WP_001255609.1.86451 WP_001255609.1.86454 WP_001255609.1.86492 WP_001255609.1.8652 WP_001255609.1.86583 WP_001255609.1.86598 WP_001255609.1.86617 WP_001255609.1.86640 WP_001255609.1.86667 WP_001255609.1.86674 WP_001255609.1.86956 WP_001255609.1.87075 WP_001255609.1.8711 WP_001255609.1.87249 WP_001255609.1.87310 WP_001255609.1.87358 WP_001255609.1.87400 WP_001255609.1.87410 WP_001255609.1.87465 WP_001255609.1.87557 WP_001255609.1.87568 WP_001255609.1.87607 WP_001255609.1.87639 WP_001255609.1.87694 WP_001255609.1.87788 WP_001255609.1.87789 WP_001255609.1.87822 WP_001255609.1.88088 WP_001255609.1.88155 WP_001255609.1.88252 WP_001255609.1.88376 WP_001255609.1.88384 WP_001255609.1.88427 WP_001255609.1.88535 WP_001255609.1.88539 WP_001255609.1.88603 WP_001255609.1.88631 WP_001255609.1.88732 WP_001255609.1.88759 WP_001255609.1.88883 WP_001255609.1.88997 WP_001255609.1.89050 WP_001255609.1.8906 WP_001255609.1.89067 WP_001255609.1.89183 WP_001255609.1.89200 WP_001255609.1.8928 WP_001255609.1.8938 WP_001255609.1.894 WP_001255609.1.8945 WP_001255609.1.89474 WP_001255609.1.89479 WP_001255609.1.89492 WP_001255609.1.89646 WP_001255609.1.89710 WP_001255609.1.89768 WP_001255609.1.89818 WP_001255609.1.89839 WP_001255609.1.89859 WP_001255609.1.89915 WP_001255609.1.89918 WP_001255609.1.89920 WP_001255609.1.9009 WP_001255609.1.9010 WP_001255609.1.90156 WP_001255609.1.90270 WP_001255609.1.90405 WP_001255609.1.90435 WP_001255609.1.90441 WP_001255609.1.90547 WP_001255609.1.9059 WP_001255609.1.90626 WP_001255609.1.90706 WP_001255609.1.9081 WP_001255609.1.90822 WP_001255609.1.90834 WP_001255609.1.90839 WP_001255609.1.90856 WP_001255609.1.90864 WP_001255609.1.90873 WP_001255609.1.90979 WP_001255609.1.91094 WP_001255609.1.91266 WP_001255609.1.91290 WP_001255609.1.91397 WP_001255609.1.91414 WP_001255609.1.91485 WP_001255609.1.91511 WP_001255609.1.91565 WP_001255609.1.9157 WP_001255609.1.91596 WP_001255609.1.9160 WP_001255609.1.91643 WP_001255609.1.91644 WP_001255609.1.91672 WP_001255609.1.91685 WP_001255609.1.9171 WP_001255609.1.91782 WP_001255609.1.91787 WP_001255609.1.91863 WP_001255609.1.91959 WP_001255609.1.91971 WP_001255609.1.92048 WP_001255609.1.921 WP_001255609.1.92102 WP_001255609.1.92163 WP_001255609.1.92215 WP_001255609.1.92311 WP_001255609.1.92434 WP_001255609.1.92532 WP_001255609.1.9255 WP_001255609.1.92719 WP_001255609.1.92780 WP_001255609.1.93005 WP_001255609.1.93033 WP_001255609.1.93072 WP_001255609.1.93338 WP_001255609.1.93379 WP_001255609.1.93531 WP_001255609.1.93626 WP_001255609.1.93665 WP_001255609.1.93733 WP_001255609.1.93743 WP_001255609.1.93877 WP_001255609.1.93918 WP_001255609.1.93951 WP_001255609.1.94008 WP_001255609.1.94156 WP_001255609.1.94232 WP_001255609.1.94298 WP_001255609.1.94317 WP_001255609.1.94353 WP_001255609.1.94468 WP_001255609.1.94475 WP_001255609.1.94507 WP_001255609.1.94580 WP_001255609.1.94695 WP_001255609.1.94787 WP_001255609.1.94806 WP_001255609.1.94808 WP_001255609.1.94822 WP_001255609.1.94903 WP_001255609.1.9491 WP_001255609.1.94993 WP_001255609.1.95022 WP_001255609.1.9513 WP_001255609.1.95161 WP_001255609.1.95198 WP_001255609.1.95243 WP_001255609.1.95244 WP_001255609.1.95368 WP_001255609.1.95381 WP_001255609.1.95400 WP_001255609.1.95424 WP_001255609.1.95490 WP_001255609.1.95563 WP_001255609.1.9559 WP_001255609.1.95604 WP_001255609.1.95655 WP_001255609.1.95865 WP_001255609.1.95916 WP_001255609.1.96053 WP_001255609.1.96066 WP_001255609.1.96086 WP_001255609.1.96114 WP_001255609.1.96177 WP_001255609.1.96222 WP_001255609.1.96247 WP_001255609.1.96341 WP_001255609.1.96457 WP_001255609.1.965 WP_001255609.1.96562 WP_001255609.1.96585 WP_001255609.1.9661 WP_001255609.1.96743 WP_001255609.1.96817 WP_001255609.1.9690 WP_001255609.1.9691 WP_001255609.1.96924 WP_001255609.1.96944 WP_001255609.1.97200 WP_001255609.1.97248 WP_001255609.1.97361 WP_001255609.1.97421 WP_001255609.1.97434 WP_001255609.1.97459 WP_001255609.1.97544 WP_001255609.1.97822 WP_001255609.1.97932 WP_001255609.1.97937 WP_001255609.1.97962 WP_001255609.1.98026 WP_001255609.1.98115 WP_001255609.1.98139 WP_001255609.1.9816 WP_001255609.1.9817 WP_001255609.1.98232 WP_001255609.1.98244 WP_001255609.1.98292 WP_001255609.1.98301 WP_001255609.1.98357 WP_001255609.1.98400 WP_001255609.1.98451 WP_001255609.1.98549 WP_001255609.1.98654 WP_001255609.1.98665 WP_001255609.1.98702 WP_001255609.1.98988 WP_001255609.1.99029 WP_001255609.1.99046 WP_001255609.1.99168 WP_001255609.1.99246 WP_001255609.1.99302 WP_001255609.1.99304 WP_001255609.1.99334 WP_001255609.1.9940 WP_001255609.1.99511 WP_001255609.1.99592 WP_001255609.1.99632 WP_001255609.1.99666 WP_001255609.1.99804 WP_001255609.1.99869 YP_006778341.1.12065 gi|209919712|ref|YP_002293796.1| gi|260844854|ref|YP_003222632.1| gi|410481739|ref|YP_006769285.1| gi|218695864|ref|YP_002403531.1| 331111.EcE24377A_2557 409438.ECSE_2521 573235.ECO26_3252 585034.ECIAI1_2339 585055.EC55989_2509 585395.ECO103_2728 585396.ECO111_3012 gi|260856308|ref|YP_003230199.1| gi|157158055|ref|YP_001463609.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]