SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 331111.EcE24377A_3092 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  331111.EcE24377A_3092
Domain Number 1 Region: 138-415
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 5.63e-84
Family D-glucarate dehydratase-like 0.00000000403
Further Details:      
 
Domain Number 2 Region: 7-136
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.6e-32
Family Enolase N-terminal domain-like 0.0000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 331111.EcE24377A_3092
Sequence length 446
Comment (Escherichia coli E24377A)
Sequence
MTTQSSPVITDMKVIPVAGHDSMLLNIGGAHNAYFTRNIVVLTDNAGHTGIGEAPGGEVI
YQTLVDAIPMVLGQEVARLNKVVQQVHKGNQAADFDTFGKGAWTFELRVNAVAALEAALL
DLLGKALNVPVCELLGPGKQRETITVLGYLFYIGDRTKTDLPYLENTPGNHEWYQLRHQK
AMNSEAVVRLAEASQDRYGFKDFKLKGGVLPGEQEIDTVRALKKRFPDARITVDPNGAWL
LDEAISLCKGLNDVLTYAEDPCGAEQGFSGREVMAEFRRATGLPVATNMIATNWREMGHA
VMLNAVDIPLADPHFWTLSGAVRVAQLCDDWGLTWGCHSNNHFDISLAMFTHVGAAAPGN
PTAIDTHWIWQEGDCRLTKNPLEIKNGKIAVPDAPGLGVELDWEQVQKAHEAYKRLPVGA
RNDAGPMQYLIPGWTFDRKRPVFGRH
Download sequence
Identical sequences A0A026V9K1 A0A070FGK2 A0A0F3SBZ8 A0A1H0DUQ5 A0A1X3KZQ6 A7ZQN1 B6I6I4 C8UAC0 D6I0B1 F4NJE6 I0VU18 I2WJR4 I2WWZ8
gi|260845434|ref|YP_003223212.1| gi|157157733|ref|YP_001464110.1| WP_000211758.1.100252 WP_000211758.1.100283 WP_000211758.1.100571 WP_000211758.1.100573 WP_000211758.1.100752 WP_000211758.1.100778 WP_000211758.1.100933 WP_000211758.1.101096 WP_000211758.1.101102 WP_000211758.1.101257 WP_000211758.1.10126 WP_000211758.1.101289 WP_000211758.1.10173 WP_000211758.1.101865 WP_000211758.1.10190 WP_000211758.1.101947 WP_000211758.1.10379 WP_000211758.1.10651 WP_000211758.1.1073 WP_000211758.1.1074 WP_000211758.1.10922 WP_000211758.1.10989 WP_000211758.1.11032 WP_000211758.1.11071 WP_000211758.1.112 WP_000211758.1.1122 WP_000211758.1.11578 WP_000211758.1.11748 WP_000211758.1.11801 WP_000211758.1.12279 WP_000211758.1.12320 WP_000211758.1.12478 WP_000211758.1.12781 WP_000211758.1.12831 WP_000211758.1.12876 WP_000211758.1.13162 WP_000211758.1.13301 WP_000211758.1.13437 WP_000211758.1.13525 WP_000211758.1.13791 WP_000211758.1.13924 WP_000211758.1.14417 WP_000211758.1.14432 WP_000211758.1.14582 WP_000211758.1.14601 WP_000211758.1.14672 WP_000211758.1.14993 WP_000211758.1.15087 WP_000211758.1.15193 WP_000211758.1.15300 WP_000211758.1.15332 WP_000211758.1.15377 WP_000211758.1.15416 WP_000211758.1.1543 WP_000211758.1.15444 WP_000211758.1.15469 WP_000211758.1.15521 WP_000211758.1.1561 WP_000211758.1.15752 WP_000211758.1.15791 WP_000211758.1.15809 WP_000211758.1.15945 WP_000211758.1.15983 WP_000211758.1.16087 WP_000211758.1.1621 WP_000211758.1.163 WP_000211758.1.16388 WP_000211758.1.16539 WP_000211758.1.16745 WP_000211758.1.16805 WP_000211758.1.16861 WP_000211758.1.1710 WP_000211758.1.17242 WP_000211758.1.17297 WP_000211758.1.17356 WP_000211758.1.17373 WP_000211758.1.17392 WP_000211758.1.17403 WP_000211758.1.17417 WP_000211758.1.1769 WP_000211758.1.17829 WP_000211758.1.17984 WP_000211758.1.18000 WP_000211758.1.18094 WP_000211758.1.18338 WP_000211758.1.18410 WP_000211758.1.18482 WP_000211758.1.18649 WP_000211758.1.18714 WP_000211758.1.188 WP_000211758.1.18923 WP_000211758.1.19090 WP_000211758.1.19297 WP_000211758.1.19312 WP_000211758.1.19389 WP_000211758.1.19544 WP_000211758.1.19557 WP_000211758.1.20251 WP_000211758.1.20325 WP_000211758.1.20483 WP_000211758.1.20785 WP_000211758.1.20824 WP_000211758.1.20848 WP_000211758.1.21441 WP_000211758.1.21519 WP_000211758.1.21596 WP_000211758.1.21812 WP_000211758.1.21948 WP_000211758.1.22138 WP_000211758.1.22599 WP_000211758.1.22631 WP_000211758.1.22685 WP_000211758.1.23026 WP_000211758.1.23035 WP_000211758.1.23290 WP_000211758.1.23383 WP_000211758.1.23915 WP_000211758.1.23950 WP_000211758.1.24068 WP_000211758.1.24122 WP_000211758.1.24374 WP_000211758.1.24381 WP_000211758.1.24473 WP_000211758.1.24483 WP_000211758.1.24536 WP_000211758.1.24642 WP_000211758.1.24650 WP_000211758.1.2479 WP_000211758.1.24929 WP_000211758.1.24939 WP_000211758.1.24946 WP_000211758.1.2504 WP_000211758.1.25087 WP_000211758.1.25414 WP_000211758.1.25548 WP_000211758.1.25631 WP_000211758.1.25945 WP_000211758.1.26061 WP_000211758.1.26100 WP_000211758.1.26130 WP_000211758.1.26161 WP_000211758.1.26264 WP_000211758.1.26325 WP_000211758.1.26331 WP_000211758.1.26569 WP_000211758.1.26658 WP_000211758.1.26683 WP_000211758.1.26716 WP_000211758.1.26912 WP_000211758.1.26943 WP_000211758.1.27141 WP_000211758.1.27234 WP_000211758.1.27524 WP_000211758.1.27698 WP_000211758.1.27723 WP_000211758.1.27741 WP_000211758.1.27758 WP_000211758.1.27876 WP_000211758.1.2811 WP_000211758.1.28110 WP_000211758.1.2826 WP_000211758.1.28305 WP_000211758.1.28401 WP_000211758.1.2881 WP_000211758.1.28950 WP_000211758.1.28953 WP_000211758.1.29001 WP_000211758.1.29125 WP_000211758.1.29150 WP_000211758.1.29176 WP_000211758.1.29194 WP_000211758.1.29206 WP_000211758.1.29503 WP_000211758.1.2954 WP_000211758.1.29590 WP_000211758.1.29683 WP_000211758.1.29724 WP_000211758.1.29812 WP_000211758.1.29840 WP_000211758.1.29874 WP_000211758.1.30098 WP_000211758.1.30105 WP_000211758.1.30452 WP_000211758.1.30733 WP_000211758.1.30742 WP_000211758.1.30906 WP_000211758.1.31295 WP_000211758.1.31709 WP_000211758.1.31740 WP_000211758.1.31835 WP_000211758.1.31924 WP_000211758.1.3215 WP_000211758.1.32184 WP_000211758.1.32232 WP_000211758.1.32406 WP_000211758.1.32443 WP_000211758.1.32811 WP_000211758.1.33014 WP_000211758.1.33475 WP_000211758.1.33595 WP_000211758.1.33638 WP_000211758.1.33823 WP_000211758.1.34206 WP_000211758.1.34794 WP_000211758.1.35006 WP_000211758.1.35365 WP_000211758.1.35376 WP_000211758.1.35464 WP_000211758.1.35468 WP_000211758.1.35604 WP_000211758.1.35922 WP_000211758.1.35934 WP_000211758.1.36071 WP_000211758.1.36412 WP_000211758.1.36500 WP_000211758.1.36610 WP_000211758.1.36806 WP_000211758.1.36826 WP_000211758.1.37252 WP_000211758.1.37476 WP_000211758.1.37554 WP_000211758.1.37634 WP_000211758.1.37926 WP_000211758.1.38081 WP_000211758.1.38162 WP_000211758.1.38314 WP_000211758.1.38629 WP_000211758.1.38694 WP_000211758.1.38911 WP_000211758.1.38935 WP_000211758.1.39037 WP_000211758.1.3904 WP_000211758.1.39042 WP_000211758.1.39150 WP_000211758.1.39305 WP_000211758.1.39607 WP_000211758.1.39780 WP_000211758.1.39818 WP_000211758.1.39822 WP_000211758.1.40088 WP_000211758.1.40147 WP_000211758.1.40315 WP_000211758.1.40319 WP_000211758.1.40502 WP_000211758.1.40563 WP_000211758.1.40596 WP_000211758.1.40617 WP_000211758.1.40781 WP_000211758.1.40813 WP_000211758.1.4082 WP_000211758.1.40865 WP_000211758.1.41287 WP_000211758.1.41315 WP_000211758.1.41407 WP_000211758.1.41545 WP_000211758.1.41566 WP_000211758.1.41712 WP_000211758.1.4172 WP_000211758.1.41988 WP_000211758.1.42060 WP_000211758.1.42367 WP_000211758.1.42480 WP_000211758.1.42661 WP_000211758.1.42756 WP_000211758.1.42891 WP_000211758.1.42937 WP_000211758.1.42950 WP_000211758.1.43132 WP_000211758.1.43474 WP_000211758.1.43642 WP_000211758.1.44075 WP_000211758.1.44292 WP_000211758.1.44524 WP_000211758.1.44587 WP_000211758.1.44608 WP_000211758.1.44756 WP_000211758.1.44961 WP_000211758.1.45053 WP_000211758.1.45301 WP_000211758.1.45600 WP_000211758.1.45840 WP_000211758.1.45865 WP_000211758.1.45930 WP_000211758.1.4600 WP_000211758.1.46027 WP_000211758.1.46070 WP_000211758.1.46081 WP_000211758.1.4613 WP_000211758.1.46239 WP_000211758.1.46257 WP_000211758.1.46301 WP_000211758.1.4646 WP_000211758.1.46477 WP_000211758.1.46614 WP_000211758.1.46860 WP_000211758.1.46882 WP_000211758.1.46990 WP_000211758.1.47246 WP_000211758.1.47307 WP_000211758.1.47319 WP_000211758.1.47370 WP_000211758.1.47398 WP_000211758.1.4740 WP_000211758.1.47477 WP_000211758.1.47962 WP_000211758.1.47976 WP_000211758.1.48615 WP_000211758.1.48921 WP_000211758.1.49190 WP_000211758.1.49312 WP_000211758.1.49481 WP_000211758.1.4949 WP_000211758.1.49546 WP_000211758.1.49558 WP_000211758.1.49722 WP_000211758.1.49879 WP_000211758.1.49987 WP_000211758.1.50036 WP_000211758.1.50207 WP_000211758.1.50353 WP_000211758.1.50361 WP_000211758.1.50412 WP_000211758.1.50715 WP_000211758.1.50939 WP_000211758.1.51109 WP_000211758.1.51248 WP_000211758.1.5128 WP_000211758.1.51405 WP_000211758.1.51427 WP_000211758.1.51707 WP_000211758.1.51837 WP_000211758.1.51985 WP_000211758.1.5239 WP_000211758.1.52662 WP_000211758.1.52710 WP_000211758.1.52801 WP_000211758.1.52846 WP_000211758.1.52908 WP_000211758.1.52913 WP_000211758.1.52995 WP_000211758.1.53065 WP_000211758.1.53155 WP_000211758.1.53238 WP_000211758.1.53242 WP_000211758.1.53262 WP_000211758.1.53356 WP_000211758.1.5362 WP_000211758.1.53642 WP_000211758.1.53809 WP_000211758.1.54013 WP_000211758.1.54072 WP_000211758.1.54185 WP_000211758.1.54317 WP_000211758.1.54359 WP_000211758.1.54546 WP_000211758.1.5460 WP_000211758.1.54688 WP_000211758.1.54708 WP_000211758.1.54725 WP_000211758.1.54729 WP_000211758.1.5479 WP_000211758.1.54798 WP_000211758.1.54918 WP_000211758.1.54991 WP_000211758.1.55041 WP_000211758.1.55134 WP_000211758.1.55144 WP_000211758.1.55381 WP_000211758.1.55552 WP_000211758.1.55597 WP_000211758.1.5570 WP_000211758.1.55709 WP_000211758.1.56216 WP_000211758.1.56231 WP_000211758.1.56371 WP_000211758.1.56399 WP_000211758.1.56439 WP_000211758.1.56513 WP_000211758.1.56665 WP_000211758.1.56704 WP_000211758.1.56721 WP_000211758.1.56799 WP_000211758.1.5685 WP_000211758.1.57100 WP_000211758.1.57222 WP_000211758.1.5748 WP_000211758.1.57638 WP_000211758.1.57738 WP_000211758.1.57920 WP_000211758.1.58045 WP_000211758.1.58206 WP_000211758.1.58267 WP_000211758.1.58289 WP_000211758.1.58371 WP_000211758.1.58514 WP_000211758.1.58528 WP_000211758.1.58547 WP_000211758.1.58622 WP_000211758.1.5906 WP_000211758.1.59199 WP_000211758.1.59434 WP_000211758.1.59621 WP_000211758.1.59717 WP_000211758.1.59737 WP_000211758.1.60491 WP_000211758.1.6064 WP_000211758.1.60698 WP_000211758.1.61035 WP_000211758.1.61225 WP_000211758.1.61292 WP_000211758.1.61512 WP_000211758.1.61758 WP_000211758.1.61806 WP_000211758.1.62264 WP_000211758.1.62290 WP_000211758.1.62337 WP_000211758.1.62460 WP_000211758.1.62646 WP_000211758.1.62769 WP_000211758.1.62818 WP_000211758.1.62973 WP_000211758.1.63177 WP_000211758.1.63370 WP_000211758.1.63393 WP_000211758.1.63466 WP_000211758.1.63470 WP_000211758.1.63484 WP_000211758.1.63491 WP_000211758.1.63536 WP_000211758.1.63576 WP_000211758.1.63666 WP_000211758.1.64008 WP_000211758.1.64150 WP_000211758.1.64175 WP_000211758.1.64193 WP_000211758.1.64286 WP_000211758.1.64458 WP_000211758.1.64528 WP_000211758.1.64693 WP_000211758.1.65023 WP_000211758.1.65097 WP_000211758.1.65151 WP_000211758.1.65155 WP_000211758.1.65179 WP_000211758.1.65305 WP_000211758.1.65413 WP_000211758.1.65581 WP_000211758.1.65708 WP_000211758.1.66007 WP_000211758.1.66094 WP_000211758.1.66412 WP_000211758.1.66758 WP_000211758.1.66783 WP_000211758.1.66948 WP_000211758.1.67026 WP_000211758.1.67120 WP_000211758.1.678 WP_000211758.1.67841 WP_000211758.1.68039 WP_000211758.1.68241 WP_000211758.1.68255 WP_000211758.1.68278 WP_000211758.1.68566 WP_000211758.1.68673 WP_000211758.1.68678 WP_000211758.1.68751 WP_000211758.1.68956 WP_000211758.1.694 WP_000211758.1.69551 WP_000211758.1.69689 WP_000211758.1.69786 WP_000211758.1.69887 WP_000211758.1.70414 WP_000211758.1.70582 WP_000211758.1.70592 WP_000211758.1.70694 WP_000211758.1.70745 WP_000211758.1.70748 WP_000211758.1.71042 WP_000211758.1.71162 WP_000211758.1.71354 WP_000211758.1.71537 WP_000211758.1.71540 WP_000211758.1.71680 WP_000211758.1.71767 WP_000211758.1.7192 WP_000211758.1.71987 WP_000211758.1.72021 WP_000211758.1.72053 WP_000211758.1.72125 WP_000211758.1.72153 WP_000211758.1.72261 WP_000211758.1.72521 WP_000211758.1.72535 WP_000211758.1.72608 WP_000211758.1.72643 WP_000211758.1.72725 WP_000211758.1.72729 WP_000211758.1.72758 WP_000211758.1.73010 WP_000211758.1.73072 WP_000211758.1.73197 WP_000211758.1.73239 WP_000211758.1.73249 WP_000211758.1.73349 WP_000211758.1.73428 WP_000211758.1.73468 WP_000211758.1.73700 WP_000211758.1.73807 WP_000211758.1.73882 WP_000211758.1.73995 WP_000211758.1.74423 WP_000211758.1.74478 WP_000211758.1.74491 WP_000211758.1.74624 WP_000211758.1.74652 WP_000211758.1.74670 WP_000211758.1.74687 WP_000211758.1.74895 WP_000211758.1.75050 WP_000211758.1.75112 WP_000211758.1.75254 WP_000211758.1.75360 WP_000211758.1.75465 WP_000211758.1.7603 WP_000211758.1.76036 WP_000211758.1.76103 WP_000211758.1.76129 WP_000211758.1.76384 WP_000211758.1.76387 WP_000211758.1.76595 WP_000211758.1.7661 WP_000211758.1.76619 WP_000211758.1.76965 WP_000211758.1.7699 WP_000211758.1.77015 WP_000211758.1.77070 WP_000211758.1.77147 WP_000211758.1.77163 WP_000211758.1.77258 WP_000211758.1.77341 WP_000211758.1.77437 WP_000211758.1.77495 WP_000211758.1.77551 WP_000211758.1.77581 WP_000211758.1.77929 WP_000211758.1.77949 WP_000211758.1.7808 WP_000211758.1.78099 WP_000211758.1.78337 WP_000211758.1.78610 WP_000211758.1.7883 WP_000211758.1.78854 WP_000211758.1.78891 WP_000211758.1.78966 WP_000211758.1.79065 WP_000211758.1.79346 WP_000211758.1.7937 WP_000211758.1.79391 WP_000211758.1.79525 WP_000211758.1.79800 WP_000211758.1.79932 WP_000211758.1.80043 WP_000211758.1.80071 WP_000211758.1.80176 WP_000211758.1.80310 WP_000211758.1.80484 WP_000211758.1.80754 WP_000211758.1.80894 WP_000211758.1.80985 WP_000211758.1.811 WP_000211758.1.81104 WP_000211758.1.81182 WP_000211758.1.81469 WP_000211758.1.81484 WP_000211758.1.81869 WP_000211758.1.82062 WP_000211758.1.82240 WP_000211758.1.82378 WP_000211758.1.82485 WP_000211758.1.82831 WP_000211758.1.83564 WP_000211758.1.83947 WP_000211758.1.84172 WP_000211758.1.84313 WP_000211758.1.84348 WP_000211758.1.84436 WP_000211758.1.84473 WP_000211758.1.84841 WP_000211758.1.84850 WP_000211758.1.85011 WP_000211758.1.85098 WP_000211758.1.85112 WP_000211758.1.85335 WP_000211758.1.85342 WP_000211758.1.85525 WP_000211758.1.85857 WP_000211758.1.85939 WP_000211758.1.86115 WP_000211758.1.86181 WP_000211758.1.86263 WP_000211758.1.86307 WP_000211758.1.86393 WP_000211758.1.86411 WP_000211758.1.86454 WP_000211758.1.86492 WP_000211758.1.86674 WP_000211758.1.86707 WP_000211758.1.86833 WP_000211758.1.8687 WP_000211758.1.86956 WP_000211758.1.87109 WP_000211758.1.87310 WP_000211758.1.87358 WP_000211758.1.87400 WP_000211758.1.87639 WP_000211758.1.87694 WP_000211758.1.87976 WP_000211758.1.88088 WP_000211758.1.88238 WP_000211758.1.88252 WP_000211758.1.88285 WP_000211758.1.88384 WP_000211758.1.88427 WP_000211758.1.88462 WP_000211758.1.88539 WP_000211758.1.88598 WP_000211758.1.88646 WP_000211758.1.88759 WP_000211758.1.88997 WP_000211758.1.89050 WP_000211758.1.8906 WP_000211758.1.89183 WP_000211758.1.89197 WP_000211758.1.8938 WP_000211758.1.894 WP_000211758.1.89432 WP_000211758.1.8945 WP_000211758.1.89474 WP_000211758.1.89601 WP_000211758.1.89646 WP_000211758.1.89768 WP_000211758.1.89895 WP_000211758.1.89915 WP_000211758.1.89918 WP_000211758.1.89920 WP_000211758.1.9010 WP_000211758.1.90156 WP_000211758.1.90266 WP_000211758.1.90270 WP_000211758.1.90332 WP_000211758.1.90405 WP_000211758.1.90435 WP_000211758.1.9059 WP_000211758.1.90591 WP_000211758.1.9061 WP_000211758.1.9081 WP_000211758.1.90822 WP_000211758.1.90979 WP_000211758.1.91094 WP_000211758.1.91268 WP_000211758.1.91397 WP_000211758.1.9160 WP_000211758.1.91643 WP_000211758.1.91644 WP_000211758.1.91672 WP_000211758.1.91685 WP_000211758.1.91782 WP_000211758.1.91951 WP_000211758.1.92014 WP_000211758.1.92163 WP_000211758.1.92311 WP_000211758.1.92532 WP_000211758.1.92577 WP_000211758.1.9266 WP_000211758.1.92693 WP_000211758.1.93016 WP_000211758.1.93072 WP_000211758.1.93100 WP_000211758.1.93252 WP_000211758.1.93509 WP_000211758.1.93531 WP_000211758.1.93665 WP_000211758.1.93733 WP_000211758.1.93743 WP_000211758.1.93745 WP_000211758.1.93873 WP_000211758.1.93877 WP_000211758.1.93918 WP_000211758.1.94008 WP_000211758.1.94156 WP_000211758.1.94475 WP_000211758.1.94580 WP_000211758.1.94889 WP_000211758.1.95022 WP_000211758.1.95368 WP_000211758.1.95381 WP_000211758.1.95390 WP_000211758.1.95424 WP_000211758.1.95490 WP_000211758.1.95771 WP_000211758.1.95824 WP_000211758.1.95916 WP_000211758.1.96053 WP_000211758.1.96066 WP_000211758.1.96222 WP_000211758.1.96494 WP_000211758.1.96562 WP_000211758.1.9690 WP_000211758.1.96936 WP_000211758.1.97049 WP_000211758.1.97059 WP_000211758.1.97200 WP_000211758.1.97356 WP_000211758.1.97705 WP_000211758.1.97822 WP_000211758.1.97962 WP_000211758.1.9803 WP_000211758.1.98139 WP_000211758.1.9817 WP_000211758.1.98239 WP_000211758.1.98400 WP_000211758.1.98654 WP_000211758.1.98683 WP_000211758.1.99029 WP_000211758.1.99168 WP_000211758.1.99295 WP_000211758.1.99302 WP_000211758.1.99334 WP_000211758.1.99345 WP_000211758.1.99475 WP_000211758.1.99632 WP_000211758.1.99804 WP_000211758.1.99827 gi|209920237|ref|YP_002294321.1| 331111.EcE24377A_3092 409438.ECSE_3046 585395.ECO103_3331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]