SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 331112.EcHS_A2389 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  331112.EcHS_A2389
Domain Number 1 Region: 149-401
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.83e-55
Family D-glucarate dehydratase-like 0.0016
Further Details:      
 
Domain Number 2 Region: 45-162
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.54e-23
Family Enolase N-terminal domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 331112.EcHS_A2389
Sequence length 405
Comment (Escherichia coli HS)
Sequence
MENIMTLPKIKQVRAWFTGGATAEKGAGGGDYHDQGANHWIDDHIATPMSKYRDYEQSRQ
SFGINVLGTLVVEVEAENGQTGFAVSTAGEMGCFIVEKHLNRFIEGKCVSDIKLIHDQML
SATLYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVYKLLGGAVRDEIQFYATGARPDLA
KEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKCGEDFWLMLDCWMSQDVNYATKLA
HACAPYNLKWIEECLPPQQYEGYRELKRNAPVGMMVTSGEHHGTLQSFRTLSETGIDIMQ
PDVGWCGGLTTLVEIAAIAKSRGQLVVPHGSSVYSHHAVITFTNTPFSEFLMTSPDCSTM
RPQFDPILLNEPVPVNGRIHKSVLDKPGFGVELNRDCNLKRPYSH
Download sequence
Identical sequences A8A2B3
WP_000427846.1.19441 WP_000427846.1.20958 WP_000427846.1.25126 WP_000427846.1.27098 WP_000427846.1.2755 WP_000427846.1.342 WP_000427846.1.38843 WP_000427846.1.4290 WP_000427846.1.6993 WP_000427846.1.75209 WP_000427846.1.75653 WP_000427846.1.76211 WP_000427846.1.78615 WP_000427846.1.80050 WP_000427846.1.9631 gi|157161732|ref|YP_001459050.1| 331112.EcHS_A2389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]