SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 331112.EcHS_A3385 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  331112.EcHS_A3385
Domain Number 1 Region: 6-91
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000275
Family Anti-sigma factor antagonist SpoIIaa 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 331112.EcHS_A3385
Sequence length 97
Comment (Escherichia coli HS)
Sequence
MSESLSWMQTGDTLALSGELDQDVLLPLWEMREEAVKGITCIDLSRVSRVDTGGLALLLH
LIDLAKKQGNNVTLQGVNDKVYTLAKLYNLPADVLPR
Download sequence
Identical sequences A0A026V218 A0A027U3D7 A0A028AIR0 A0A028EDB2 A0A062Y4Q6 A0A064TD02 A0A069XTT8 A0A070FLS7 A0A070SYY1 A0A070UXK2 A0A073G2B7 A0A073H6P3 A0A073UPP7 A0A074HRQ3 A0A080FKU9 A0A080IHP0 A0A090NYD2 A0A0A8UET9 A0A0E0U4D5 A0A0E0XX76 A0A0E1M222 A0A0E1SYY4 A0A0F6C9G1 A0A0F6FCQ8 A0A0G3K9A1 A0A0H3ML84 A0A0H3PS82 A0A0I3SPY5 A0A0M9J515 A0A125WXT1 A0A127GPY1 A0A140N7B4 A0A142H761 A0A1S6TFZ9 A0A1S9JYV5 A0A1W2N1R6 A0A1X3IHR8 A0A1X3LT49 A0A1Z3UZA3 A0A222QRL7 A0A226KFI1 A0A236U1K9 A0A2H1BM34 A7ZS89 B1LGF7 B6I1R4 B7LHQ2 B7NDH5 C8TXI6 C8UGE9 D3GXT0 D6I1H1 D6IEA3 D6JF64 D7X6A2 D7XN48 D7ZEP4 D8EB12 E0J2Q3 E1ILE6 E1JED5 E2X7Z1 E3PKA1 E6BFP7 E7SLD1 E7T9D7 E9TGS4 E9XG91 E9YUU2 F5N7L4 F5P095 G0F2I8 H4UPP6 I0VVD7 I2RGD1 I2SUM2 I2UHH5 I2W8R4 I2X2H2 I2X5A9 I6BEY7 I6CFY5 I6FKI2 I6GJX2 K0WUQ2 K4UZX2 K4XPM0 L2VGZ2 L2XBQ1 L3NXX3 L3Q036 L3QCG2 L4IZM9 M9FQJ1 P64602 P64603 S0VJM3 S1EW19 S1HV01 T5UAX8 T6A2B3 T9AXT5 T9CC64 U9XUY5 U9XVN0 V0A2Z9 V0AAF1 V0SZJ0 V0X718 V0YXW2 V2RRL4 V2TDP3 V6G0E7 V8FQE4 V8KLE6 W1AQP8 W1EXA3 W1X1L0 W8T4U6
gi|253771975|ref|YP_003034806.1| 316385.ECDH10B_3365 316407.yrbB 331111.EcE24377A_3678 331112.EcHS_A3385 386585.ECs4070 409438.ECSE_3475 413997.ECB_03056 439855.EcSMS35_3487 444450.ECH74115_4513 469008.ECBD_0551 481805.EcolC_0509 511145.b3191 544404.ECSP_4166 573235.ECO26_4295 585034.ECIAI1_3339 585055.EC55989_3609 585056.ECUMN_3671 585057.ECIAI39_3686 585395.ECO103_3938 585396.ECO111_4016 595496.BWG_2893 gi|387613881|ref|YP_006116997.1| gi|387622853|ref|YP_006130481.1| gi|387884375|ref|YP_006314677.1| gi|251786461|ref|YP_003000765.1| gi|532141297|ref|NP_708990.2| gi|218701960|ref|YP_002409589.1| gi|471334751|ref|YP_007558228.1| gi|407480178|ref|YP_006777327.1| gi|410480739|ref|YP_006768285.1| gi|378711354|ref|YP_005276247.1| gi|218696896|ref|YP_002404563.1| gi|560159201|ref|YP_008851916.1| gi|386711098|ref|YP_006174819.1| gi|387622853|ref|YP_006130481.1| gi|386615979|ref|YP_006135645.1| gi|378711354|ref|YP_005276247.1| NP_312097.2.58667 NP_417658.4.90541 NP_708990.2.23235 WP_000004488.1.10001 WP_000004488.1.100044 WP_000004488.1.100063 WP_000004488.1.100066 WP_000004488.1.100073 WP_000004488.1.100085 WP_000004488.1.10010 WP_000004488.1.100111 WP_000004488.1.100116 WP_000004488.1.100135 WP_000004488.1.100138 WP_000004488.1.100159 WP_000004488.1.100185 WP_000004488.1.100194 WP_000004488.1.100251 WP_000004488.1.100252 WP_000004488.1.100283 WP_000004488.1.100285 WP_000004488.1.100299 WP_000004488.1.100302 WP_000004488.1.100315 WP_000004488.1.10034 WP_000004488.1.100346 WP_000004488.1.100389 WP_000004488.1.100425 WP_000004488.1.100441 WP_000004488.1.100444 WP_000004488.1.100447 WP_000004488.1.100448 WP_000004488.1.100451 WP_000004488.1.10048 WP_000004488.1.100487 WP_000004488.1.100499 WP_000004488.1.100508 WP_000004488.1.10051 WP_000004488.1.100531 WP_000004488.1.100543 WP_000004488.1.100554 WP_000004488.1.100571 WP_000004488.1.100573 WP_000004488.1.100614 WP_000004488.1.100667 WP_000004488.1.10067 WP_000004488.1.10068 WP_000004488.1.100688 WP_000004488.1.100689 WP_000004488.1.100718 WP_000004488.1.100725 WP_000004488.1.100752 WP_000004488.1.100753 WP_000004488.1.100758 WP_000004488.1.100778 WP_000004488.1.100796 WP_000004488.1.10080 WP_000004488.1.100824 WP_000004488.1.100836 WP_000004488.1.100851 WP_000004488.1.100852 WP_000004488.1.10086 WP_000004488.1.100867 WP_000004488.1.100868 WP_000004488.1.100916 WP_000004488.1.100925 WP_000004488.1.100928 WP_000004488.1.100933 WP_000004488.1.10094 WP_000004488.1.100966 WP_000004488.1.100990 WP_000004488.1.10100 WP_000004488.1.101033 WP_000004488.1.101096 WP_000004488.1.1011 WP_000004488.1.101102 WP_000004488.1.101105 WP_000004488.1.101110 WP_000004488.1.101121 WP_000004488.1.101157 WP_000004488.1.101158 WP_000004488.1.101166 WP_000004488.1.101175 WP_000004488.1.101186 WP_000004488.1.101206 WP_000004488.1.101214 WP_000004488.1.101216 WP_000004488.1.101255 WP_000004488.1.101257 WP_000004488.1.10126 WP_000004488.1.101282 WP_000004488.1.101293 WP_000004488.1.101313 WP_000004488.1.101359 WP_000004488.1.101418 WP_000004488.1.101423 WP_000004488.1.101430 WP_000004488.1.101436 WP_000004488.1.101445 WP_000004488.1.101468 WP_000004488.1.101486 WP_000004488.1.101522 WP_000004488.1.10154 WP_000004488.1.101545 WP_000004488.1.101583 WP_000004488.1.101594 WP_000004488.1.101628 WP_000004488.1.101630 WP_000004488.1.101651 WP_000004488.1.101653 WP_000004488.1.101667 WP_000004488.1.101668 WP_000004488.1.101686 WP_000004488.1.101727 WP_000004488.1.10173 WP_000004488.1.101737 WP_000004488.1.101747 WP_000004488.1.101769 WP_000004488.1.101777 WP_000004488.1.101786 WP_000004488.1.101822 WP_000004488.1.10184 WP_000004488.1.101840 WP_000004488.1.101845 WP_000004488.1.101865 WP_000004488.1.10187 WP_000004488.1.10188 WP_000004488.1.101887 WP_000004488.1.101889 WP_000004488.1.10190 WP_000004488.1.101900 WP_000004488.1.101908 WP_000004488.1.101913 WP_000004488.1.101937 WP_000004488.1.101940 WP_000004488.1.101942 WP_000004488.1.101947 WP_000004488.1.101948 WP_000004488.1.101952 WP_000004488.1.101962 WP_000004488.1.102021 WP_000004488.1.10206 WP_000004488.1.102069 WP_000004488.1.102093 WP_000004488.1.102094 WP_000004488.1.102122 WP_000004488.1.102139 WP_000004488.1.10222 WP_000004488.1.10226 WP_000004488.1.10233 WP_000004488.1.10235 WP_000004488.1.10252 WP_000004488.1.10273 WP_000004488.1.10304 WP_000004488.1.10329 WP_000004488.1.10335 WP_000004488.1.10348 WP_000004488.1.10352 WP_000004488.1.10361 WP_000004488.1.10379 WP_000004488.1.10381 WP_000004488.1.1040 WP_000004488.1.10400 WP_000004488.1.10417 WP_000004488.1.10461 WP_000004488.1.10476 WP_000004488.1.10491 WP_000004488.1.10496 WP_000004488.1.10508 WP_000004488.1.10525 WP_000004488.1.10538 WP_000004488.1.10569 WP_000004488.1.10576 WP_000004488.1.10579 WP_000004488.1.1058 WP_000004488.1.10605 WP_000004488.1.10607 WP_000004488.1.10628 WP_000004488.1.10651 WP_000004488.1.10673 WP_000004488.1.10705 WP_000004488.1.1071 WP_000004488.1.10715 WP_000004488.1.10729 WP_000004488.1.1073 WP_000004488.1.1074 WP_000004488.1.10744 WP_000004488.1.10748 WP_000004488.1.10761 WP_000004488.1.10763 WP_000004488.1.10771 WP_000004488.1.10798 WP_000004488.1.10809 WP_000004488.1.10814 WP_000004488.1.10833 WP_000004488.1.10862 WP_000004488.1.10922 WP_000004488.1.10940 WP_000004488.1.10970 WP_000004488.1.10988 WP_000004488.1.10989 WP_000004488.1.10995 WP_000004488.1.11006 WP_000004488.1.11032 WP_000004488.1.11047 WP_000004488.1.11071 WP_000004488.1.11091 WP_000004488.1.1111 WP_000004488.1.11121 WP_000004488.1.1113 WP_000004488.1.11133 WP_000004488.1.112 WP_000004488.1.1122 WP_000004488.1.11240 WP_000004488.1.11241 WP_000004488.1.11251 WP_000004488.1.11265 WP_000004488.1.11272 WP_000004488.1.11296 WP_000004488.1.11301 WP_000004488.1.11323 WP_000004488.1.11408 WP_000004488.1.11418 WP_000004488.1.11420 WP_000004488.1.11436 WP_000004488.1.11440 WP_000004488.1.11452 WP_000004488.1.11499 WP_000004488.1.11524 WP_000004488.1.11578 WP_000004488.1.11595 WP_000004488.1.11616 WP_000004488.1.11645 WP_000004488.1.11671 WP_000004488.1.11673 WP_000004488.1.1168 WP_000004488.1.11690 WP_000004488.1.11699 WP_000004488.1.11748 WP_000004488.1.11759 WP_000004488.1.1176 WP_000004488.1.11762 WP_000004488.1.11801 WP_000004488.1.11844 WP_000004488.1.1186 WP_000004488.1.11912 WP_000004488.1.11949 WP_000004488.1.11955 WP_000004488.1.11956 WP_000004488.1.1196 WP_000004488.1.11981 WP_000004488.1.11982 WP_000004488.1.11985 WP_000004488.1.12000 WP_000004488.1.12030 WP_000004488.1.12051 WP_000004488.1.12060 WP_000004488.1.12095 WP_000004488.1.12112 WP_000004488.1.12115 WP_000004488.1.1212 WP_000004488.1.1218 WP_000004488.1.12204 WP_000004488.1.12259 WP_000004488.1.12279 WP_000004488.1.12292 WP_000004488.1.12305 WP_000004488.1.12319 WP_000004488.1.12320 WP_000004488.1.12342 WP_000004488.1.12344 WP_000004488.1.12352 WP_000004488.1.12415 WP_000004488.1.1242 WP_000004488.1.12426 WP_000004488.1.12458 WP_000004488.1.12459 WP_000004488.1.12468 WP_000004488.1.12478 WP_000004488.1.12542 WP_000004488.1.12552 WP_000004488.1.12558 WP_000004488.1.12566 WP_000004488.1.12574 WP_000004488.1.12582 WP_000004488.1.12594 WP_000004488.1.12623 WP_000004488.1.12645 WP_000004488.1.12675 WP_000004488.1.12679 WP_000004488.1.12680 WP_000004488.1.12693 WP_000004488.1.12697 WP_000004488.1.127 WP_000004488.1.12717 WP_000004488.1.12743 WP_000004488.1.12749 WP_000004488.1.1275 WP_000004488.1.12756 WP_000004488.1.12762 WP_000004488.1.12781 WP_000004488.1.1280 WP_000004488.1.12831 WP_000004488.1.12876 WP_000004488.1.12893 WP_000004488.1.12911 WP_000004488.1.12914 WP_000004488.1.12944 WP_000004488.1.1295 WP_000004488.1.12965 WP_000004488.1.12979 WP_000004488.1.12987 WP_000004488.1.13002 WP_000004488.1.13015 WP_000004488.1.13031 WP_000004488.1.13060 WP_000004488.1.13074 WP_000004488.1.1308 WP_000004488.1.1312 WP_000004488.1.13136 WP_000004488.1.1315 WP_000004488.1.13157 WP_000004488.1.13162 WP_000004488.1.13176 WP_000004488.1.13205 WP_000004488.1.13217 WP_000004488.1.13222 WP_000004488.1.13223 WP_000004488.1.13239 WP_000004488.1.13252 WP_000004488.1.13258 WP_000004488.1.13271 WP_000004488.1.13278 WP_000004488.1.13281 WP_000004488.1.13290 WP_000004488.1.13295 WP_000004488.1.13301 WP_000004488.1.13332 WP_000004488.1.13333 WP_000004488.1.13346 WP_000004488.1.13348 WP_000004488.1.1335 WP_000004488.1.13383 WP_000004488.1.13393 WP_000004488.1.13411 WP_000004488.1.13430 WP_000004488.1.13437 WP_000004488.1.13442 WP_000004488.1.1345 WP_000004488.1.13469 WP_000004488.1.13473 WP_000004488.1.13481 WP_000004488.1.13492 WP_000004488.1.13495 WP_000004488.1.13525 WP_000004488.1.13566 WP_000004488.1.13585 WP_000004488.1.13589 WP_000004488.1.13601 WP_000004488.1.13608 WP_000004488.1.13618 WP_000004488.1.13644 WP_000004488.1.13656 WP_000004488.1.13662 WP_000004488.1.13664 WP_000004488.1.13672 WP_000004488.1.13740 WP_000004488.1.13791 WP_000004488.1.13798 WP_000004488.1.13824 WP_000004488.1.13867 WP_000004488.1.13877 WP_000004488.1.13881 WP_000004488.1.13891 WP_000004488.1.13924 WP_000004488.1.13936 WP_000004488.1.13939 WP_000004488.1.13944 WP_000004488.1.13949 WP_000004488.1.13974 WP_000004488.1.13981 WP_000004488.1.14030 WP_000004488.1.14042 WP_000004488.1.14058 WP_000004488.1.14062 WP_000004488.1.14070 WP_000004488.1.14094 WP_000004488.1.14110 WP_000004488.1.14127 WP_000004488.1.14129 WP_000004488.1.14154 WP_000004488.1.1419 WP_000004488.1.14199 WP_000004488.1.142 WP_000004488.1.14277 WP_000004488.1.14292 WP_000004488.1.14299 WP_000004488.1.14304 WP_000004488.1.14346 WP_000004488.1.1438 WP_000004488.1.14389 WP_000004488.1.1439 WP_000004488.1.14398 WP_000004488.1.14417 WP_000004488.1.14432 WP_000004488.1.14451 WP_000004488.1.14453 WP_000004488.1.14468 WP_000004488.1.14493 WP_000004488.1.14499 WP_000004488.1.14501 WP_000004488.1.14506 WP_000004488.1.14508 WP_000004488.1.14529 WP_000004488.1.14536 WP_000004488.1.14582 WP_000004488.1.14601 WP_000004488.1.1461 WP_000004488.1.14616 WP_000004488.1.14621 WP_000004488.1.14648 WP_000004488.1.14661 WP_000004488.1.14672 WP_000004488.1.14678 WP_000004488.1.14693 WP_000004488.1.1470 WP_000004488.1.14711 WP_000004488.1.14746 WP_000004488.1.14748 WP_000004488.1.14749 WP_000004488.1.14811 WP_000004488.1.14833 WP_000004488.1.1486 WP_000004488.1.14861 WP_000004488.1.14871 WP_000004488.1.14934 WP_000004488.1.14956 WP_000004488.1.14958 WP_000004488.1.14965 WP_000004488.1.14977 WP_000004488.1.14992 WP_000004488.1.14993 WP_000004488.1.15007 WP_000004488.1.1508 WP_000004488.1.15087 WP_000004488.1.15090 WP_000004488.1.1510 WP_000004488.1.15117 WP_000004488.1.1512 WP_000004488.1.15121 WP_000004488.1.15138 WP_000004488.1.15148 WP_000004488.1.15177 WP_000004488.1.15191 WP_000004488.1.15193 WP_000004488.1.15221 WP_000004488.1.1524 WP_000004488.1.15245 WP_000004488.1.15252 WP_000004488.1.15259 WP_000004488.1.15270 WP_000004488.1.15277 WP_000004488.1.15282 WP_000004488.1.15287 WP_000004488.1.153 WP_000004488.1.15300 WP_000004488.1.15332 WP_000004488.1.15335 WP_000004488.1.15347 WP_000004488.1.15356 WP_000004488.1.15377 WP_000004488.1.15416 WP_000004488.1.1543 WP_000004488.1.15444 WP_000004488.1.15469 WP_000004488.1.15496 WP_000004488.1.1550 WP_000004488.1.15503 WP_000004488.1.15521 WP_000004488.1.15527 WP_000004488.1.15528 WP_000004488.1.15538 WP_000004488.1.15565 WP_000004488.1.15576 WP_000004488.1.1559 WP_000004488.1.15593 WP_000004488.1.15600 WP_000004488.1.1561 WP_000004488.1.15626 WP_000004488.1.15645 WP_000004488.1.15702 WP_000004488.1.15707 WP_000004488.1.15740 WP_000004488.1.15747 WP_000004488.1.15752 WP_000004488.1.15762 WP_000004488.1.15767 WP_000004488.1.15771 WP_000004488.1.15782 WP_000004488.1.15791 WP_000004488.1.1580 WP_000004488.1.15809 WP_000004488.1.1582 WP_000004488.1.15855 WP_000004488.1.1588 WP_000004488.1.15894 WP_000004488.1.15906 WP_000004488.1.15916 WP_000004488.1.15945 WP_000004488.1.15949 WP_000004488.1.15951 WP_000004488.1.15983 WP_000004488.1.16014 WP_000004488.1.16015 WP_000004488.1.16034 WP_000004488.1.16042 WP_000004488.1.16075 WP_000004488.1.16086 WP_000004488.1.16087 WP_000004488.1.1609 WP_000004488.1.16102 WP_000004488.1.16111 WP_000004488.1.16117 WP_000004488.1.16133 WP_000004488.1.16154 WP_000004488.1.16171 WP_000004488.1.16179 WP_000004488.1.16188 WP_000004488.1.16194 WP_000004488.1.1621 WP_000004488.1.16222 WP_000004488.1.16272 WP_000004488.1.16294 WP_000004488.1.163 WP_000004488.1.16303 WP_000004488.1.1634 WP_000004488.1.16387 WP_000004488.1.16388 WP_000004488.1.1640 WP_000004488.1.16435 WP_000004488.1.16463 WP_000004488.1.16481 WP_000004488.1.16482 WP_000004488.1.16500 WP_000004488.1.16517 WP_000004488.1.16532 WP_000004488.1.16539 WP_000004488.1.16541 WP_000004488.1.1655 WP_000004488.1.16577 WP_000004488.1.16592 WP_000004488.1.16604 WP_000004488.1.16612 WP_000004488.1.16640 WP_000004488.1.16648 WP_000004488.1.16667 WP_000004488.1.16669 WP_000004488.1.16682 WP_000004488.1.16685 WP_000004488.1.16700 WP_000004488.1.16715 WP_000004488.1.16721 WP_000004488.1.1673 WP_000004488.1.16745 WP_000004488.1.16752 WP_000004488.1.16766 WP_000004488.1.16780 WP_000004488.1.16805 WP_000004488.1.16818 WP_000004488.1.16845 WP_000004488.1.16861 WP_000004488.1.16894 WP_000004488.1.16970 WP_000004488.1.16979 WP_000004488.1.16992 WP_000004488.1.17018 WP_000004488.1.17042 WP_000004488.1.17061 WP_000004488.1.17084 WP_000004488.1.17085 WP_000004488.1.17087 WP_000004488.1.17089 WP_000004488.1.1710 WP_000004488.1.17101 WP_000004488.1.17102 WP_000004488.1.17109 WP_000004488.1.17111 WP_000004488.1.17114 WP_000004488.1.17119 WP_000004488.1.17123 WP_000004488.1.17150 WP_000004488.1.17170 WP_000004488.1.17172 WP_000004488.1.17186 WP_000004488.1.17187 WP_000004488.1.17205 WP_000004488.1.17216 WP_000004488.1.17230 WP_000004488.1.17242 WP_000004488.1.1726 WP_000004488.1.17267 WP_000004488.1.17282 WP_000004488.1.17290 WP_000004488.1.17297 WP_000004488.1.17300 WP_000004488.1.17301 WP_000004488.1.1731 WP_000004488.1.17333 WP_000004488.1.17356 WP_000004488.1.17360 WP_000004488.1.17373 WP_000004488.1.17386 WP_000004488.1.17389 WP_000004488.1.17392 WP_000004488.1.17403 WP_000004488.1.17410 WP_000004488.1.17415 WP_000004488.1.17417 WP_000004488.1.17432 WP_000004488.1.17441 WP_000004488.1.17464 WP_000004488.1.17496 WP_000004488.1.17515 WP_000004488.1.17534 WP_000004488.1.1755 WP_000004488.1.17568 WP_000004488.1.17570 WP_000004488.1.17577 WP_000004488.1.17595 WP_000004488.1.17623 WP_000004488.1.1763 WP_000004488.1.17637 WP_000004488.1.1766 WP_000004488.1.17680 WP_000004488.1.1769 WP_000004488.1.17711 WP_000004488.1.1772 WP_000004488.1.17765 WP_000004488.1.17769 WP_000004488.1.1778 WP_000004488.1.17802 WP_000004488.1.17829 WP_000004488.1.17831 WP_000004488.1.17836 WP_000004488.1.17889 WP_000004488.1.17904 WP_000004488.1.17920 WP_000004488.1.17937 WP_000004488.1.17961 WP_000004488.1.17963 WP_000004488.1.17984 WP_000004488.1.18000 WP_000004488.1.18006 WP_000004488.1.18064 WP_000004488.1.18094 WP_000004488.1.18112 WP_000004488.1.18133 WP_000004488.1.18134 WP_000004488.1.18136 WP_000004488.1.18175 WP_000004488.1.18225 WP_000004488.1.18226 WP_000004488.1.18229 WP_000004488.1.18311 WP_000004488.1.18316 WP_000004488.1.18326 WP_000004488.1.18329 WP_000004488.1.18338 WP_000004488.1.1834 WP_000004488.1.18340 WP_000004488.1.18354 WP_000004488.1.18381 WP_000004488.1.18383 WP_000004488.1.18402 WP_000004488.1.18410 WP_000004488.1.18436 WP_000004488.1.18438 WP_000004488.1.1844 WP_000004488.1.18458 WP_000004488.1.18461 WP_000004488.1.18472 WP_000004488.1.18482 WP_000004488.1.18511 WP_000004488.1.18530 WP_000004488.1.18550 WP_000004488.1.18583 WP_000004488.1.18588 WP_000004488.1.1861 WP_000004488.1.18617 WP_000004488.1.1862 WP_000004488.1.18628 WP_000004488.1.18649 WP_000004488.1.18650 WP_000004488.1.18651 WP_000004488.1.18655 WP_000004488.1.1866 WP_000004488.1.1867 WP_000004488.1.18675 WP_000004488.1.18714 WP_000004488.1.18726 WP_000004488.1.1873 WP_000004488.1.18734 WP_000004488.1.18794 WP_000004488.1.188 WP_000004488.1.18801 WP_000004488.1.18806 WP_000004488.1.1881 WP_000004488.1.18837 WP_000004488.1.18843 WP_000004488.1.18858 WP_000004488.1.18861 WP_000004488.1.18874 WP_000004488.1.18876 WP_000004488.1.18899 WP_000004488.1.18923 WP_000004488.1.18936 WP_000004488.1.18966 WP_000004488.1.18983 WP_000004488.1.18995 WP_000004488.1.19024 WP_000004488.1.1903 WP_000004488.1.19039 WP_000004488.1.1906 WP_000004488.1.19075 WP_000004488.1.1909 WP_000004488.1.19090 WP_000004488.1.191 WP_000004488.1.19100 WP_000004488.1.19113 WP_000004488.1.19114 WP_000004488.1.19122 WP_000004488.1.19129 WP_000004488.1.19140 WP_000004488.1.19147 WP_000004488.1.19148 WP_000004488.1.1915 WP_000004488.1.19150 WP_000004488.1.19194 WP_000004488.1.19205 WP_000004488.1.19206 WP_000004488.1.1925 WP_000004488.1.19276 WP_000004488.1.19277 WP_000004488.1.19297 WP_000004488.1.193 WP_000004488.1.19312 WP_000004488.1.19313 WP_000004488.1.19314 WP_000004488.1.19315 WP_000004488.1.19332 WP_000004488.1.19338 WP_000004488.1.19350 WP_000004488.1.19361 WP_000004488.1.19389 WP_000004488.1.19397 WP_000004488.1.19419 WP_000004488.1.19424 WP_000004488.1.19441 WP_000004488.1.19448 WP_000004488.1.19453 WP_000004488.1.19478 WP_000004488.1.19487 WP_000004488.1.19494 WP_000004488.1.1952 WP_000004488.1.19544 WP_000004488.1.19557 WP_000004488.1.19581 WP_000004488.1.19583 WP_000004488.1.19602 WP_000004488.1.1963 WP_000004488.1.19644 WP_000004488.1.19649 WP_000004488.1.19655 WP_000004488.1.19684 WP_000004488.1.19691 WP_000004488.1.19758 WP_000004488.1.19778 WP_000004488.1.19795 WP_000004488.1.1982 WP_000004488.1.19830 WP_000004488.1.19838 WP_000004488.1.19840 WP_000004488.1.19845 WP_000004488.1.19847 WP_000004488.1.19861 WP_000004488.1.19873 WP_000004488.1.19878 WP_000004488.1.19889 WP_000004488.1.19940 WP_000004488.1.19945 WP_000004488.1.19957 WP_000004488.1.19994 WP_000004488.1.20025 WP_000004488.1.2005 WP_000004488.1.20096 WP_000004488.1.20114 WP_000004488.1.20129 WP_000004488.1.20133 WP_000004488.1.20136 WP_000004488.1.2015 WP_000004488.1.20151 WP_000004488.1.20157 WP_000004488.1.20159 WP_000004488.1.20164 WP_000004488.1.20166 WP_000004488.1.20170 WP_000004488.1.20178 WP_000004488.1.20192 WP_000004488.1.20215 WP_000004488.1.2022 WP_000004488.1.20230 WP_000004488.1.20251 WP_000004488.1.20264 WP_000004488.1.20277 WP_000004488.1.20290 WP_000004488.1.20308 WP_000004488.1.20318 WP_000004488.1.20325 WP_000004488.1.20331 WP_000004488.1.20334 WP_000004488.1.20370 WP_000004488.1.20388 WP_000004488.1.20445 WP_000004488.1.20449 WP_000004488.1.20480 WP_000004488.1.20483 WP_000004488.1.20484 WP_000004488.1.20493 WP_000004488.1.20506 WP_000004488.1.20515 WP_000004488.1.20519 WP_000004488.1.20536 WP_000004488.1.20546 WP_000004488.1.20549 WP_000004488.1.20594 WP_000004488.1.20596 WP_000004488.1.2063 WP_000004488.1.20636 WP_000004488.1.20638 WP_000004488.1.20662 WP_000004488.1.20668 WP_000004488.1.20691 WP_000004488.1.20724 WP_000004488.1.20730 WP_000004488.1.20737 WP_000004488.1.20745 WP_000004488.1.2075 WP_000004488.1.20765 WP_000004488.1.20785 WP_000004488.1.20813 WP_000004488.1.20824 WP_000004488.1.20831 WP_000004488.1.20841 WP_000004488.1.20848 WP_000004488.1.20863 WP_000004488.1.20893 WP_000004488.1.20907 WP_000004488.1.2093 WP_000004488.1.2094 WP_000004488.1.20941 WP_000004488.1.20943 WP_000004488.1.20950 WP_000004488.1.20958 WP_000004488.1.20982 WP_000004488.1.20989 WP_000004488.1.2100 WP_000004488.1.21017 WP_000004488.1.21020 WP_000004488.1.21022 WP_000004488.1.21029 WP_000004488.1.21033 WP_000004488.1.21041 WP_000004488.1.21057 WP_000004488.1.21059 WP_000004488.1.21104 WP_000004488.1.21122 WP_000004488.1.21129 WP_000004488.1.2113 WP_000004488.1.21131 WP_000004488.1.21137 WP_000004488.1.21171 WP_000004488.1.21197 WP_000004488.1.21251 WP_000004488.1.21255 WP_000004488.1.21277 WP_000004488.1.21305 WP_000004488.1.21320 WP_000004488.1.21336 WP_000004488.1.2142 WP_000004488.1.21441 WP_000004488.1.21450 WP_000004488.1.21470 WP_000004488.1.21508 WP_000004488.1.21519 WP_000004488.1.2156 WP_000004488.1.21573 WP_000004488.1.21578 WP_000004488.1.21596 WP_000004488.1.21628 WP_000004488.1.21637 WP_000004488.1.21661 WP_000004488.1.21666 WP_000004488.1.21667 WP_000004488.1.21668 WP_000004488.1.21673 WP_000004488.1.21696 WP_000004488.1.21727 WP_000004488.1.21732 WP_000004488.1.21733 WP_000004488.1.21758 WP_000004488.1.21762 WP_000004488.1.21771 WP_000004488.1.21811 WP_000004488.1.21812 WP_000004488.1.21823 WP_000004488.1.21895 WP_000004488.1.21915 WP_000004488.1.21945 WP_000004488.1.21948 WP_000004488.1.21962 WP_000004488.1.2198 WP_000004488.1.21986 WP_000004488.1.21992 WP_000004488.1.22021 WP_000004488.1.22060 WP_000004488.1.22098 WP_000004488.1.22113 WP_000004488.1.22138 WP_000004488.1.2218 WP_000004488.1.22195 WP_000004488.1.22204 WP_000004488.1.22251 WP_000004488.1.22268 WP_000004488.1.22269 WP_000004488.1.22280 WP_000004488.1.22291 WP_000004488.1.22295 WP_000004488.1.22304 WP_000004488.1.22314 WP_000004488.1.2232 WP_000004488.1.22328 WP_000004488.1.22350 WP_000004488.1.22359 WP_000004488.1.22363 WP_000004488.1.22381 WP_000004488.1.22409 WP_000004488.1.22431 WP_000004488.1.22450 WP_000004488.1.22470 WP_000004488.1.22494 WP_000004488.1.22501 WP_000004488.1.22522 WP_000004488.1.22544 WP_000004488.1.22571 WP_000004488.1.22572 WP_000004488.1.22574 WP_000004488.1.22579 WP_000004488.1.22594 WP_000004488.1.22599 WP_000004488.1.22602 WP_000004488.1.22631 WP_000004488.1.22632 WP_000004488.1.22641 WP_000004488.1.22649 WP_000004488.1.22662 WP_000004488.1.22669 WP_000004488.1.22685 WP_000004488.1.22690 WP_000004488.1.22691 WP_000004488.1.22743 WP_000004488.1.22759 WP_000004488.1.22771 WP_000004488.1.22777 WP_000004488.1.22783 WP_000004488.1.22809 WP_000004488.1.22814 WP_000004488.1.22827 WP_000004488.1.22830 WP_000004488.1.22846 WP_000004488.1.22868 WP_000004488.1.22875 WP_000004488.1.22878 WP_000004488.1.22885 WP_000004488.1.22896 WP_000004488.1.22908 WP_000004488.1.22925 WP_000004488.1.22961 WP_000004488.1.22988 WP_000004488.1.22990 WP_000004488.1.2300 WP_000004488.1.23005 WP_000004488.1.23026 WP_000004488.1.23035 WP_000004488.1.23042 WP_000004488.1.23044 WP_000004488.1.23045 WP_000004488.1.23057 WP_000004488.1.23062 WP_000004488.1.23073 WP_000004488.1.23078 WP_000004488.1.23081 WP_000004488.1.23090 WP_000004488.1.23092 WP_000004488.1.23105 WP_000004488.1.23115 WP_000004488.1.23120 WP_000004488.1.23135 WP_000004488.1.23241 WP_000004488.1.23257 WP_000004488.1.23270 WP_000004488.1.23290 WP_000004488.1.23293 WP_000004488.1.23323 WP_000004488.1.23330 WP_000004488.1.23351 WP_000004488.1.23352 WP_000004488.1.23355 WP_000004488.1.23376 WP_000004488.1.23378 WP_000004488.1.23383 WP_000004488.1.23388 WP_000004488.1.23393 WP_000004488.1.23443 WP_000004488.1.23456 WP_000004488.1.23463 WP_000004488.1.23467 WP_000004488.1.23487 WP_000004488.1.23511 WP_000004488.1.23520 WP_000004488.1.23527 WP_000004488.1.2353 WP_000004488.1.23549 WP_000004488.1.23554 WP_000004488.1.23561 WP_000004488.1.23563 WP_000004488.1.23584 WP_000004488.1.23593 WP_000004488.1.2362 WP_000004488.1.23622 WP_000004488.1.23625 WP_000004488.1.23640 WP_000004488.1.23660 WP_000004488.1.23676 WP_000004488.1.23693 WP_000004488.1.23724 WP_000004488.1.23729 WP_000004488.1.23741 WP_000004488.1.23752 WP_000004488.1.23754 WP_000004488.1.23765 WP_000004488.1.23790 WP_000004488.1.23795 WP_000004488.1.23804 WP_000004488.1.23806 WP_000004488.1.23812 WP_000004488.1.23838 WP_000004488.1.2388 WP_000004488.1.23881 WP_000004488.1.23886 WP_000004488.1.23895 WP_000004488.1.23898 WP_000004488.1.23899 WP_000004488.1.23914 WP_000004488.1.23915 WP_000004488.1.23931 WP_000004488.1.23945 WP_000004488.1.2395 WP_000004488.1.23950 WP_000004488.1.23953 WP_000004488.1.23960 WP_000004488.1.23971 WP_000004488.1.23973 WP_000004488.1.23984 WP_000004488.1.23985 WP_000004488.1.24 WP_000004488.1.24024 WP_000004488.1.24045 WP_000004488.1.24051 WP_000004488.1.24058 WP_000004488.1.24068 WP_000004488.1.24070 WP_000004488.1.24088 WP_000004488.1.24089 WP_000004488.1.24120 WP_000004488.1.24122 WP_000004488.1.24124 WP_000004488.1.2413 WP_000004488.1.24136 WP_000004488.1.2418 WP_000004488.1.24194 WP_000004488.1.24278 WP_000004488.1.2428 WP_000004488.1.24283 WP_000004488.1.24290 WP_000004488.1.2430 WP_000004488.1.24304 WP_000004488.1.24316 WP_000004488.1.2433 WP_000004488.1.24341 WP_000004488.1.24362 WP_000004488.1.2437 WP_000004488.1.24374 WP_000004488.1.24381 WP_000004488.1.24383 WP_000004488.1.24458 WP_000004488.1.24460 WP_000004488.1.24473 WP_000004488.1.24483 WP_000004488.1.24485 WP_000004488.1.24523 WP_000004488.1.24533 WP_000004488.1.24536 WP_000004488.1.24547 WP_000004488.1.2456 WP_000004488.1.24560 WP_000004488.1.24570 WP_000004488.1.24575 WP_000004488.1.24583 WP_000004488.1.24592 WP_000004488.1.24616 WP_000004488.1.24641 WP_000004488.1.24642 WP_000004488.1.24646 WP_000004488.1.24650 WP_000004488.1.24693 WP_000004488.1.24695 WP_000004488.1.24752 WP_000004488.1.24753 WP_000004488.1.24758 WP_000004488.1.24763 WP_000004488.1.24783 WP_000004488.1.2479 WP_000004488.1.24791 WP_000004488.1.24799 WP_000004488.1.24808 WP_000004488.1.24849 WP_000004488.1.24870 WP_000004488.1.24876 WP_000004488.1.24899 WP_000004488.1.24926 WP_000004488.1.24929 WP_000004488.1.24939 WP_000004488.1.24946 WP_000004488.1.24960 WP_000004488.1.24981 WP_000004488.1.24982 WP_000004488.1.24984 WP_000004488.1.25019 WP_000004488.1.25038 WP_000004488.1.25039 WP_000004488.1.2504 WP_000004488.1.25042 WP_000004488.1.25060 WP_000004488.1.25076 WP_000004488.1.25082 WP_000004488.1.25085 WP_000004488.1.25086 WP_000004488.1.25087 WP_000004488.1.25088 WP_000004488.1.25126 WP_000004488.1.25141 WP_000004488.1.25183 WP_000004488.1.25193 WP_000004488.1.25201 WP_000004488.1.25203 WP_000004488.1.25204 WP_000004488.1.25272 WP_000004488.1.25289 WP_000004488.1.25305 WP_000004488.1.2531 WP_000004488.1.25312 WP_000004488.1.25324 WP_000004488.1.25346 WP_000004488.1.2537 WP_000004488.1.25378 WP_000004488.1.254 WP_000004488.1.25403 WP_000004488.1.25414 WP_000004488.1.2543 WP_000004488.1.255 WP_000004488.1.25517 WP_000004488.1.25525 WP_000004488.1.25526 WP_000004488.1.25548 WP_000004488.1.25577 WP_000004488.1.2558 WP_000004488.1.25592 WP_000004488.1.25598 WP_000004488.1.25602 WP_000004488.1.25613 WP_000004488.1.25631 WP_000004488.1.25643 WP_000004488.1.25652 WP_000004488.1.25681 WP_000004488.1.25713 WP_000004488.1.25717 WP_000004488.1.25718 WP_000004488.1.25724 WP_000004488.1.25726 WP_000004488.1.25753 WP_000004488.1.25755 WP_000004488.1.25794 WP_000004488.1.25799 WP_000004488.1.25819 WP_000004488.1.25831 WP_000004488.1.25832 WP_000004488.1.25843 WP_000004488.1.25855 WP_000004488.1.2588 WP_000004488.1.25886 WP_000004488.1.2589 WP_000004488.1.25890 WP_000004488.1.25915 WP_000004488.1.25945 WP_000004488.1.2597 WP_000004488.1.25996 WP_000004488.1.26005 WP_000004488.1.26048 WP_000004488.1.26055 WP_000004488.1.26061 WP_000004488.1.26066 WP_000004488.1.26100 WP_000004488.1.26105 WP_000004488.1.2612 WP_000004488.1.26121 WP_000004488.1.26130 WP_000004488.1.26134 WP_000004488.1.26135 WP_000004488.1.26161 WP_000004488.1.26186 WP_000004488.1.26191 WP_000004488.1.26246 WP_000004488.1.26262 WP_000004488.1.26270 WP_000004488.1.26325 WP_000004488.1.26331 WP_000004488.1.26379 WP_000004488.1.26391 WP_000004488.1.26419 WP_000004488.1.2642 WP_000004488.1.26467 WP_000004488.1.26474 WP_000004488.1.26479 WP_000004488.1.26480 WP_000004488.1.26517 WP_000004488.1.26525 WP_000004488.1.26569 WP_000004488.1.26570 WP_000004488.1.26575 WP_000004488.1.26588 WP_000004488.1.26590 WP_000004488.1.26598 WP_000004488.1.26609 WP_000004488.1.26613 WP_000004488.1.2665 WP_000004488.1.26658 WP_000004488.1.26683 WP_000004488.1.26716 WP_000004488.1.26720 WP_000004488.1.26761 WP_000004488.1.26766 WP_000004488.1.26839 WP_000004488.1.26878 WP_000004488.1.26912 WP_000004488.1.26941 WP_000004488.1.26943 WP_000004488.1.2695 WP_000004488.1.26975 WP_000004488.1.26998 WP_000004488.1.27019 WP_000004488.1.27057 WP_000004488.1.27060 WP_000004488.1.27098 WP_000004488.1.27105 WP_000004488.1.2712 WP_000004488.1.27134 WP_000004488.1.27141 WP_000004488.1.27148 WP_000004488.1.27175 WP_000004488.1.27188 WP_000004488.1.27214 WP_000004488.1.27234 WP_000004488.1.27260 WP_000004488.1.27283 WP_000004488.1.27287 WP_000004488.1.27292 WP_000004488.1.2731 WP_000004488.1.27310 WP_000004488.1.27313 WP_000004488.1.27330 WP_000004488.1.27338 WP_000004488.1.27396 WP_000004488.1.27424 WP_000004488.1.27445 WP_000004488.1.27451 WP_000004488.1.27472 WP_000004488.1.27504 WP_000004488.1.27518 WP_000004488.1.27524 WP_000004488.1.27560 WP_000004488.1.27580 WP_000004488.1.27585 WP_000004488.1.27611 WP_000004488.1.27683 WP_000004488.1.27693 WP_000004488.1.27698 WP_000004488.1.27723 WP_000004488.1.27741 WP_000004488.1.27742 WP_000004488.1.27749 WP_000004488.1.27758 WP_000004488.1.27774 WP_000004488.1.27786 WP_000004488.1.2782 WP_000004488.1.27846 WP_000004488.1.27856 WP_000004488.1.27876 WP_000004488.1.27879 WP_000004488.1.27897 WP_000004488.1.27923 WP_000004488.1.27957 WP_000004488.1.27971 WP_000004488.1.28046 WP_000004488.1.28102 WP_000004488.1.28109 WP_000004488.1.2811 WP_000004488.1.28110 WP_000004488.1.28128 WP_000004488.1.28143 WP_000004488.1.28168 WP_000004488.1.28184 WP_000004488.1.2826 WP_000004488.1.28268 WP_000004488.1.28271 WP_000004488.1.28305 WP_000004488.1.28322 WP_000004488.1.28401 WP_000004488.1.28414 WP_000004488.1.28433 WP_000004488.1.28440 WP_000004488.1.28480 WP_000004488.1.28491 WP_000004488.1.28509 WP_000004488.1.28523 WP_000004488.1.28536 WP_000004488.1.28551 WP_000004488.1.28554 WP_000004488.1.28639 WP_000004488.1.28662 WP_000004488.1.28683 WP_000004488.1.28697 WP_000004488.1.28711 WP_000004488.1.28734 WP_000004488.1.28760 WP_000004488.1.28762 WP_000004488.1.28769 WP_000004488.1.28791 WP_000004488.1.28809 WP_000004488.1.2881 WP_000004488.1.28835 WP_000004488.1.28879 WP_000004488.1.28919 WP_000004488.1.28953 WP_000004488.1.28982 WP_000004488.1.28994 WP_000004488.1.29001 WP_000004488.1.29013 WP_000004488.1.29016 WP_000004488.1.29049 WP_000004488.1.29061 WP_000004488.1.29079 WP_000004488.1.29082 WP_000004488.1.291 WP_000004488.1.29100 WP_000004488.1.29118 WP_000004488.1.29125 WP_000004488.1.29126 WP_000004488.1.29128 WP_000004488.1.29146 WP_000004488.1.29150 WP_000004488.1.29164 WP_000004488.1.29176 WP_000004488.1.29194 WP_000004488.1.29197 WP_000004488.1.29202 WP_000004488.1.29206 WP_000004488.1.29221 WP_000004488.1.29230 WP_000004488.1.29239 WP_000004488.1.29252 WP_000004488.1.2926 WP_000004488.1.2931 WP_000004488.1.29394 WP_000004488.1.29404 WP_000004488.1.2942 WP_000004488.1.2945 WP_000004488.1.29486 WP_000004488.1.29495 WP_000004488.1.29497 WP_000004488.1.29503 WP_000004488.1.29504 WP_000004488.1.2952 WP_000004488.1.2954 WP_000004488.1.29556 WP_000004488.1.29564 WP_000004488.1.29590 WP_000004488.1.29597 WP_000004488.1.29603 WP_000004488.1.29618 WP_000004488.1.29643 WP_000004488.1.29669 WP_000004488.1.29683 WP_000004488.1.29699 WP_000004488.1.29715 WP_000004488.1.29724 WP_000004488.1.29740 WP_000004488.1.29746 WP_000004488.1.2978 WP_000004488.1.29798 WP_000004488.1.29812 WP_000004488.1.29815 WP_000004488.1.29818 WP_000004488.1.29821 WP_000004488.1.29840 WP_000004488.1.29874 WP_000004488.1.29876 WP_000004488.1.29884 WP_000004488.1.29933 WP_000004488.1.2995 WP_000004488.1.29976 WP_000004488.1.29988 WP_000004488.1.29992 WP_000004488.1.30 WP_000004488.1.30004 WP_000004488.1.30016 WP_000004488.1.30019 WP_000004488.1.30035 WP_000004488.1.30052 WP_000004488.1.30064 WP_000004488.1.30098 WP_000004488.1.30105 WP_000004488.1.30141 WP_000004488.1.30164 WP_000004488.1.30221 WP_000004488.1.30231 WP_000004488.1.30247 WP_000004488.1.30253 WP_000004488.1.30347 WP_000004488.1.30401 WP_000004488.1.30428 WP_000004488.1.3045 WP_000004488.1.30452 WP_000004488.1.30472 WP_000004488.1.30476 WP_000004488.1.30479 WP_000004488.1.30497 WP_000004488.1.30546 WP_000004488.1.30554 WP_000004488.1.30580 WP_000004488.1.306 WP_000004488.1.3063 WP_000004488.1.30630 WP_000004488.1.30637 WP_000004488.1.30639 WP_000004488.1.30640 WP_000004488.1.30700 WP_000004488.1.30733 WP_000004488.1.30749 WP_000004488.1.30762 WP_000004488.1.30783 WP_000004488.1.30808 WP_000004488.1.30843 WP_000004488.1.30853 WP_000004488.1.30866 WP_000004488.1.30906 WP_000004488.1.30918 WP_000004488.1.30960 WP_000004488.1.30987 WP_000004488.1.30993 WP_000004488.1.30999 WP_000004488.1.31009 WP_000004488.1.31026 WP_000004488.1.31055 WP_000004488.1.31083 WP_000004488.1.31142 WP_000004488.1.31149 WP_000004488.1.31188 WP_000004488.1.312 WP_000004488.1.31211 WP_000004488.1.31252 WP_000004488.1.31295 WP_000004488.1.31319 WP_000004488.1.31340 WP_000004488.1.31347 WP_000004488.1.31353 WP_000004488.1.31357 WP_000004488.1.31379 WP_000004488.1.3140 WP_000004488.1.31401 WP_000004488.1.31407 WP_000004488.1.31419 WP_000004488.1.31421 WP_000004488.1.31429 WP_000004488.1.31431 WP_000004488.1.31434 WP_000004488.1.31482 WP_000004488.1.31506 WP_000004488.1.31518 WP_000004488.1.31521 WP_000004488.1.31527 WP_000004488.1.31542 WP_000004488.1.31575 WP_000004488.1.31614 WP_000004488.1.31625 WP_000004488.1.31639 WP_000004488.1.31679 WP_000004488.1.31681 WP_000004488.1.3169 WP_000004488.1.31696 WP_000004488.1.31709 WP_000004488.1.31715 WP_000004488.1.31736 WP_000004488.1.31740 WP_000004488.1.3176 WP_000004488.1.31801 WP_000004488.1.31803 WP_000004488.1.31809 WP_000004488.1.3181 WP_000004488.1.31833 WP_000004488.1.31835 WP_000004488.1.31839 WP_000004488.1.31860 WP_000004488.1.31866 WP_000004488.1.31898 WP_000004488.1.31899 WP_000004488.1.31903 WP_000004488.1.31924 WP_000004488.1.31928 WP_000004488.1.3193 WP_000004488.1.31937 WP_000004488.1.31956 WP_000004488.1.31978 WP_000004488.1.3201 WP_000004488.1.32020 WP_000004488.1.3203 WP_000004488.1.32030 WP_000004488.1.32037 WP_000004488.1.32049 WP_000004488.1.32063 WP_000004488.1.32078 WP_000004488.1.32089 WP_000004488.1.32091 WP_000004488.1.32093 WP_000004488.1.32094 WP_000004488.1.3212 WP_000004488.1.32121 WP_000004488.1.32127 WP_000004488.1.32138 WP_000004488.1.32142 WP_000004488.1.32143 WP_000004488.1.3215 WP_000004488.1.32173 WP_000004488.1.32184 WP_000004488.1.322 WP_000004488.1.32222 WP_000004488.1.32232 WP_000004488.1.32236 WP_000004488.1.32242 WP_000004488.1.32243 WP_000004488.1.32279 WP_000004488.1.32287 WP_000004488.1.32333 WP_000004488.1.32394 WP_000004488.1.32406 WP_000004488.1.32435 WP_000004488.1.32448 WP_000004488.1.3247 WP_000004488.1.32475 WP_000004488.1.32479 WP_000004488.1.3248 WP_000004488.1.32480 WP_000004488.1.32494 WP_000004488.1.32509 WP_000004488.1.32536 WP_000004488.1.32558 WP_000004488.1.32574 WP_000004488.1.32580 WP_000004488.1.32590 WP_000004488.1.32591 WP_000004488.1.32601 WP_000004488.1.32635 WP_000004488.1.32661 WP_000004488.1.32676 WP_000004488.1.32680 WP_000004488.1.327 WP_000004488.1.32709 WP_000004488.1.32715 WP_000004488.1.32720 WP_000004488.1.32722 WP_000004488.1.32741 WP_000004488.1.32772 WP_000004488.1.32811 WP_000004488.1.32815 WP_000004488.1.32831 WP_000004488.1.32875 WP_000004488.1.32888 WP_000004488.1.32903 WP_000004488.1.32910 WP_000004488.1.32931 WP_000004488.1.3295 WP_000004488.1.32959 WP_000004488.1.32984 WP_000004488.1.32992 WP_000004488.1.32995 WP_000004488.1.33004 WP_000004488.1.33014 WP_000004488.1.33022 WP_000004488.1.33026 WP_000004488.1.33049 WP_000004488.1.33053 WP_000004488.1.33055 WP_000004488.1.33094 WP_000004488.1.33101 WP_000004488.1.33119 WP_000004488.1.33125 WP_000004488.1.33146 WP_000004488.1.33167 WP_000004488.1.33171 WP_000004488.1.33178 WP_000004488.1.33222 WP_000004488.1.3323 WP_000004488.1.33237 WP_000004488.1.33238 WP_000004488.1.33244 WP_000004488.1.33268 WP_000004488.1.33325 WP_000004488.1.33341 WP_000004488.1.33362 WP_000004488.1.33369 WP_000004488.1.33385 WP_000004488.1.334 WP_000004488.1.33408 WP_000004488.1.33413 WP_000004488.1.33422 WP_000004488.1.33424 WP_000004488.1.33428 WP_000004488.1.33475 WP_000004488.1.33502 WP_000004488.1.33512 WP_000004488.1.33526 WP_000004488.1.3354 WP_000004488.1.33545 WP_000004488.1.33561 WP_000004488.1.33565 WP_000004488.1.33595 WP_000004488.1.33638 WP_000004488.1.33648 WP_000004488.1.33667 WP_000004488.1.33680 WP_000004488.1.33729 WP_000004488.1.33736 WP_000004488.1.33745 WP_000004488.1.33746 WP_000004488.1.33751 WP_000004488.1.33780 WP_000004488.1.33799 WP_000004488.1.33823 WP_000004488.1.33854 WP_000004488.1.33879 WP_000004488.1.33888 WP_000004488.1.33896 WP_000004488.1.33914 WP_000004488.1.33948 WP_000004488.1.33952 WP_000004488.1.33973 WP_000004488.1.33974 WP_000004488.1.33979 WP_000004488.1.3398 WP_000004488.1.33981 WP_000004488.1.34003 WP_000004488.1.3401 WP_000004488.1.34032 WP_000004488.1.34094 WP_000004488.1.3411 WP_000004488.1.34122 WP_000004488.1.34124 WP_000004488.1.34144 WP_000004488.1.3415 WP_000004488.1.342 WP_000004488.1.34204 WP_000004488.1.34206 WP_000004488.1.34224 WP_000004488.1.34269 WP_000004488.1.34270 WP_000004488.1.34273 WP_000004488.1.34277 WP_000004488.1.34332 WP_000004488.1.34341 WP_000004488.1.34348 WP_000004488.1.34363 WP_000004488.1.34380 WP_000004488.1.34383 WP_000004488.1.34397 WP_000004488.1.34400 WP_000004488.1.3444 WP_000004488.1.34440 WP_000004488.1.34441 WP_000004488.1.34444 WP_000004488.1.34456 WP_000004488.1.34470 WP_000004488.1.34500 WP_000004488.1.34525 WP_000004488.1.34532 WP_000004488.1.34538 WP_000004488.1.34541 WP_000004488.1.34557 WP_000004488.1.34558 WP_000004488.1.34605 WP_000004488.1.34617 WP_000004488.1.34655 WP_000004488.1.34668 WP_000004488.1.34675 WP_000004488.1.34680 WP_000004488.1.34682 WP_000004488.1.34686 WP_000004488.1.347 WP_000004488.1.3472 WP_000004488.1.34727 WP_000004488.1.34781 WP_000004488.1.34794 WP_000004488.1.34827 WP_000004488.1.34838 WP_000004488.1.34855 WP_000004488.1.34966 WP_000004488.1.34982 WP_000004488.1.34983 WP_000004488.1.34990 WP_000004488.1.34993 WP_000004488.1.35003 WP_000004488.1.35006 WP_000004488.1.35012 WP_000004488.1.35114 WP_000004488.1.35132 WP_000004488.1.35168 WP_000004488.1.35180 WP_000004488.1.35186 WP_000004488.1.35195 WP_000004488.1.35202 WP_000004488.1.35204 WP_000004488.1.3521 WP_000004488.1.35211 WP_000004488.1.35220 WP_000004488.1.35316 WP_000004488.1.35349 WP_000004488.1.35360 WP_000004488.1.35365 WP_000004488.1.35368 WP_000004488.1.35376 WP_000004488.1.3539 WP_000004488.1.35393 WP_000004488.1.35398 WP_000004488.1.35448 WP_000004488.1.35464 WP_000004488.1.35465 WP_000004488.1.35466 WP_000004488.1.35468 WP_000004488.1.3550 WP_000004488.1.35552 WP_000004488.1.35604 WP_000004488.1.35649 WP_000004488.1.35651 WP_000004488.1.35653 WP_000004488.1.35654 WP_000004488.1.35698 WP_000004488.1.35704 WP_000004488.1.35724 WP_000004488.1.35740 WP_000004488.1.35744 WP_000004488.1.35789 WP_000004488.1.35904 WP_000004488.1.35927 WP_000004488.1.35934 WP_000004488.1.35942 WP_000004488.1.35959 WP_000004488.1.3598 WP_000004488.1.35990 WP_000004488.1.36010 WP_000004488.1.36040 WP_000004488.1.36042 WP_000004488.1.36070 WP_000004488.1.36071 WP_000004488.1.36085 WP_000004488.1.36094 WP_000004488.1.36105 WP_000004488.1.36129 WP_000004488.1.36159 WP_000004488.1.36164 WP_000004488.1.36166 WP_000004488.1.36177 WP_000004488.1.3620 WP_000004488.1.36212 WP_000004488.1.36281 WP_000004488.1.36299 WP_000004488.1.36332 WP_000004488.1.36334 WP_000004488.1.36352 WP_000004488.1.36386 WP_000004488.1.36393 WP_000004488.1.36412 WP_000004488.1.36426 WP_000004488.1.36453 WP_000004488.1.36496 WP_000004488.1.36500 WP_000004488.1.36507 WP_000004488.1.36523 WP_000004488.1.36531 WP_000004488.1.36537 WP_000004488.1.36610 WP_000004488.1.36626 WP_000004488.1.36627 WP_000004488.1.36628 WP_000004488.1.36667 WP_000004488.1.3668 WP_000004488.1.36699 WP_000004488.1.36707 WP_000004488.1.3671 WP_000004488.1.36739 WP_000004488.1.36746 WP_000004488.1.36747 WP_000004488.1.36767 WP_000004488.1.36806 WP_000004488.1.36812 WP_000004488.1.36826 WP_000004488.1.36833 WP_000004488.1.36856 WP_000004488.1.36886 WP_000004488.1.36904 WP_000004488.1.36925 WP_000004488.1.36971 WP_000004488.1.36975 WP_000004488.1.37006 WP_000004488.1.37020 WP_000004488.1.37046 WP_000004488.1.37049 WP_000004488.1.37057 WP_000004488.1.37076 WP_000004488.1.37099 WP_000004488.1.37101 WP_000004488.1.37102 WP_000004488.1.37122 WP_000004488.1.37146 WP_000004488.1.37153 WP_000004488.1.37155 WP_000004488.1.37206 WP_000004488.1.3723 WP_000004488.1.37233 WP_000004488.1.37252 WP_000004488.1.37261 WP_000004488.1.37290 WP_000004488.1.3730 WP_000004488.1.37329 WP_000004488.1.37334 WP_000004488.1.37337 WP_000004488.1.37352 WP_000004488.1.37360 WP_000004488.1.37371 WP_000004488.1.37372 WP_000004488.1.37419 WP_000004488.1.37433 WP_000004488.1.37445 WP_000004488.1.37472 WP_000004488.1.37476 WP_000004488.1.37485 WP_000004488.1.3749 WP_000004488.1.37510 WP_000004488.1.37516 WP_000004488.1.37538 WP_000004488.1.37543 WP_000004488.1.37549 WP_000004488.1.37554 WP_000004488.1.37576 WP_000004488.1.37588 WP_000004488.1.3762 WP_000004488.1.37634 WP_000004488.1.37637 WP_000004488.1.377 WP_000004488.1.3772 WP_000004488.1.37730 WP_000004488.1.37731 WP_000004488.1.37750 WP_000004488.1.37758 WP_000004488.1.37766 WP_000004488.1.37769 WP_000004488.1.37773 WP_000004488.1.37817 WP_000004488.1.37830 WP_000004488.1.37852 WP_000004488.1.3788 WP_000004488.1.37880 WP_000004488.1.37887 WP_000004488.1.37897 WP_000004488.1.37917 WP_000004488.1.37923 WP_000004488.1.37926 WP_000004488.1.37940 WP_000004488.1.3795 WP_000004488.1.37964 WP_000004488.1.37967 WP_000004488.1.37995 WP_000004488.1.38033 WP_000004488.1.38043 WP_000004488.1.38050 WP_000004488.1.38063 WP_000004488.1.38080 WP_000004488.1.38081 WP_000004488.1.38085 WP_000004488.1.38103 WP_000004488.1.38105 WP_000004488.1.38107 WP_000004488.1.3811 WP_000004488.1.38119 WP_000004488.1.38120 WP_000004488.1.3815 WP_000004488.1.38155 WP_000004488.1.38162 WP_000004488.1.38182 WP_000004488.1.38185 WP_000004488.1.38202 WP_000004488.1.38211 WP_000004488.1.3822 WP_000004488.1.38234 WP_000004488.1.38257 WP_000004488.1.38264 WP_000004488.1.38306 WP_000004488.1.38314 WP_000004488.1.38323 WP_000004488.1.38363 WP_000004488.1.38369 WP_000004488.1.38371 WP_000004488.1.38412 WP_000004488.1.38419 WP_000004488.1.38485 WP_000004488.1.38533 WP_000004488.1.38544 WP_000004488.1.38584 WP_000004488.1.38610 WP_000004488.1.38626 WP_000004488.1.38629 WP_000004488.1.38636 WP_000004488.1.38694 WP_000004488.1.38722 WP_000004488.1.3873 WP_000004488.1.38777 WP_000004488.1.38782 WP_000004488.1.38811 WP_000004488.1.38827 WP_000004488.1.38835 WP_000004488.1.38843 WP_000004488.1.38896 WP_000004488.1.389 WP_000004488.1.38911 WP_000004488.1.38920 WP_000004488.1.38935 WP_000004488.1.38937 WP_000004488.1.38950 WP_000004488.1.38956 WP_000004488.1.38958 WP_000004488.1.39005 WP_000004488.1.39015 WP_000004488.1.3903 WP_000004488.1.39037 WP_000004488.1.3904 WP_000004488.1.39042 WP_000004488.1.39063 WP_000004488.1.39103 WP_000004488.1.39111 WP_000004488.1.39123 WP_000004488.1.39148 WP_000004488.1.39150 WP_000004488.1.39155 WP_000004488.1.39157 WP_000004488.1.39164 WP_000004488.1.39167 WP_000004488.1.39171 WP_000004488.1.39180 WP_000004488.1.39184 WP_000004488.1.39196 WP_000004488.1.3921 WP_000004488.1.3922 WP_000004488.1.39254 WP_000004488.1.39268 WP_000004488.1.39286 WP_000004488.1.39302 WP_000004488.1.39305 WP_000004488.1.39310 WP_000004488.1.39335 WP_000004488.1.39356 WP_000004488.1.39358 WP_000004488.1.39365 WP_000004488.1.39367 WP_000004488.1.39373 WP_000004488.1.39402 WP_000004488.1.39415 WP_000004488.1.39430 WP_000004488.1.39468 WP_000004488.1.39481 WP_000004488.1.39492 WP_000004488.1.39509 WP_000004488.1.39531 WP_000004488.1.3954 WP_000004488.1.39541 WP_000004488.1.39564 WP_000004488.1.39575 WP_000004488.1.39580 WP_000004488.1.39594 WP_000004488.1.39601 WP_000004488.1.39606 WP_000004488.1.39607 WP_000004488.1.39610 WP_000004488.1.39626 WP_000004488.1.39636 WP_000004488.1.39646 WP_000004488.1.39690 WP_000004488.1.3970 WP_000004488.1.39715 WP_000004488.1.39730 WP_000004488.1.39733 WP_000004488.1.39758 WP_000004488.1.39780 WP_000004488.1.39796 WP_000004488.1.3980 WP_000004488.1.39818 WP_000004488.1.39820 WP_000004488.1.39822 WP_000004488.1.39829 WP_000004488.1.39870 WP_000004488.1.39892 WP_000004488.1.39938 WP_000004488.1.39961 WP_000004488.1.39966 WP_000004488.1.39970 WP_000004488.1.39973 WP_000004488.1.39992 WP_000004488.1.39998 WP_000004488.1.40013 WP_000004488.1.4005 WP_000004488.1.40088 WP_000004488.1.40113 WP_000004488.1.40121 WP_000004488.1.40140 WP_000004488.1.40147 WP_000004488.1.40159 WP_000004488.1.40183 WP_000004488.1.40192 WP_000004488.1.4020 WP_000004488.1.40206 WP_000004488.1.40212 WP_000004488.1.40218 WP_000004488.1.40234 WP_000004488.1.40238 WP_000004488.1.40249 WP_000004488.1.4030 WP_000004488.1.40315 WP_000004488.1.40317 WP_000004488.1.40319 WP_000004488.1.40335 WP_000004488.1.40382 WP_000004488.1.40389 WP_000004488.1.40391 WP_000004488.1.40403 WP_000004488.1.40445 WP_000004488.1.4049 WP_000004488.1.40499 WP_000004488.1.40502 WP_000004488.1.40509 WP_000004488.1.40524 WP_000004488.1.40548 WP_000004488.1.40549 WP_000004488.1.40563 WP_000004488.1.40596 WP_000004488.1.40599 WP_000004488.1.406 WP_000004488.1.40617 WP_000004488.1.40623 WP_000004488.1.40629 WP_000004488.1.40668 WP_000004488.1.40686 WP_000004488.1.40712 WP_000004488.1.40742 WP_000004488.1.40758 WP_000004488.1.40781 WP_000004488.1.40793 WP_000004488.1.4081 WP_000004488.1.40813 WP_000004488.1.40815 WP_000004488.1.4082 WP_000004488.1.40833 WP_000004488.1.40842 WP_000004488.1.40865 WP_000004488.1.40882 WP_000004488.1.40893 WP_000004488.1.40898 WP_000004488.1.40900 WP_000004488.1.40912 WP_000004488.1.40937 WP_000004488.1.40952 WP_000004488.1.40965 WP_000004488.1.4103 WP_000004488.1.41037 WP_000004488.1.41045 WP_000004488.1.41060 WP_000004488.1.41125 WP_000004488.1.41147 WP_000004488.1.41206 WP_000004488.1.41230 WP_000004488.1.41239 WP_000004488.1.41244 WP_000004488.1.41259 WP_000004488.1.4126 WP_000004488.1.41263 WP_000004488.1.41271 WP_000004488.1.41287 WP_000004488.1.41294 WP_000004488.1.41315 WP_000004488.1.41330 WP_000004488.1.41339 WP_000004488.1.41363 WP_000004488.1.41368 WP_000004488.1.41371 WP_000004488.1.41372 WP_000004488.1.41391 WP_000004488.1.41392 WP_000004488.1.41394 WP_000004488.1.41402 WP_000004488.1.41407 WP_000004488.1.41417 WP_000004488.1.4142 WP_000004488.1.41436 WP_000004488.1.41449 WP_000004488.1.41455 WP_000004488.1.41457 WP_000004488.1.41466 WP_000004488.1.41478 WP_000004488.1.41483 WP_000004488.1.41484 WP_000004488.1.41513 WP_000004488.1.41530 WP_000004488.1.41536 WP_000004488.1.41539 WP_000004488.1.41545 WP_000004488.1.41556 WP_000004488.1.41566 WP_000004488.1.4158 WP_000004488.1.41606 WP_000004488.1.41613 WP_000004488.1.41621 WP_000004488.1.41651 WP_000004488.1.41654 WP_000004488.1.41712 WP_000004488.1.41718 WP_000004488.1.4172 WP_000004488.1.41734 WP_000004488.1.41740 WP_000004488.1.41741 WP_000004488.1.41752 WP_000004488.1.41778 WP_000004488.1.41780 WP_000004488.1.41782 WP_000004488.1.41784 WP_000004488.1.41809 WP_000004488.1.41812 WP_000004488.1.41813 WP_000004488.1.41826 WP_000004488.1.41837 WP_000004488.1.41849 WP_000004488.1.41885 WP_000004488.1.41900 WP_000004488.1.4193 WP_000004488.1.41956 WP_000004488.1.41960 WP_000004488.1.41988 WP_000004488.1.41991 WP_000004488.1.42022 WP_000004488.1.42027 WP_000004488.1.42033 WP_000004488.1.42036 WP_000004488.1.42038 WP_000004488.1.42044 WP_000004488.1.42060 WP_000004488.1.42073 WP_000004488.1.42095 WP_000004488.1.42096 WP_000004488.1.42113 WP_000004488.1.4213 WP_000004488.1.42138 WP_000004488.1.4214 WP_000004488.1.42151 WP_000004488.1.42179 WP_000004488.1.42203 WP_000004488.1.42209 WP_000004488.1.42214 WP_000004488.1.42221 WP_000004488.1.42226 WP_000004488.1.42233 WP_000004488.1.4224 WP_000004488.1.42252 WP_000004488.1.42277 WP_000004488.1.42284 WP_000004488.1.42300 WP_000004488.1.42318 WP_000004488.1.42359 WP_000004488.1.42367 WP_000004488.1.42369 WP_000004488.1.42376 WP_000004488.1.42387 WP_000004488.1.42415 WP_000004488.1.4242 WP_000004488.1.42432 WP_000004488.1.42442 WP_000004488.1.42443 WP_000004488.1.42447 WP_000004488.1.42448 WP_000004488.1.42480 WP_000004488.1.4250 WP_000004488.1.42513 WP_000004488.1.42516 WP_000004488.1.42522 WP_000004488.1.42547 WP_000004488.1.42594 WP_000004488.1.4261 WP_000004488.1.42632 WP_000004488.1.42661 WP_000004488.1.42669 WP_000004488.1.42709 WP_000004488.1.42728 WP_000004488.1.42748 WP_000004488.1.42749 WP_000004488.1.42750 WP_000004488.1.42756 WP_000004488.1.42761 WP_000004488.1.42770 WP_000004488.1.42791 WP_000004488.1.42808 WP_000004488.1.42813 WP_000004488.1.4282 WP_000004488.1.42828 WP_000004488.1.42830 WP_000004488.1.42832 WP_000004488.1.42863 WP_000004488.1.42879 WP_000004488.1.42891 WP_000004488.1.4290 WP_000004488.1.42918 WP_000004488.1.42936 WP_000004488.1.42937 WP_000004488.1.42950 WP_000004488.1.42962 WP_000004488.1.42966 WP_000004488.1.42975 WP_000004488.1.42989 WP_000004488.1.43013 WP_000004488.1.43035 WP_000004488.1.4306 WP_000004488.1.43079 WP_000004488.1.43121 WP_000004488.1.43123 WP_000004488.1.4313 WP_000004488.1.43132 WP_000004488.1.43133 WP_000004488.1.43137 WP_000004488.1.43140 WP_000004488.1.43166 WP_000004488.1.43174 WP_000004488.1.43177 WP_000004488.1.43196 WP_000004488.1.43213 WP_000004488.1.43239 WP_000004488.1.43270 WP_000004488.1.43316 WP_000004488.1.43324 WP_000004488.1.4334 WP_000004488.1.43363 WP_000004488.1.43374 WP_000004488.1.43384 WP_000004488.1.43389 WP_000004488.1.4342 WP_000004488.1.43444 WP_000004488.1.43448 WP_000004488.1.43455 WP_000004488.1.43469 WP_000004488.1.43473 WP_000004488.1.43474 WP_000004488.1.43489 WP_000004488.1.43501 WP_000004488.1.43536 WP_000004488.1.43561 WP_000004488.1.43566 WP_000004488.1.43598 WP_000004488.1.436 WP_000004488.1.43604 WP_000004488.1.43622 WP_000004488.1.43642 WP_000004488.1.43720 WP_000004488.1.43738 WP_000004488.1.43750 WP_000004488.1.43754 WP_000004488.1.43769 WP_000004488.1.43798 WP_000004488.1.43804 WP_000004488.1.43816 WP_000004488.1.43837 WP_000004488.1.43858 WP_000004488.1.43911 WP_000004488.1.43918 WP_000004488.1.43939 WP_000004488.1.43966 WP_000004488.1.43989 WP_000004488.1.4400 WP_000004488.1.44018 WP_000004488.1.44029 WP_000004488.1.44040 WP_000004488.1.44075 WP_000004488.1.44077 WP_000004488.1.44088 WP_000004488.1.44096 WP_000004488.1.44100 WP_000004488.1.4411 WP_000004488.1.44115 WP_000004488.1.44125 WP_000004488.1.44130 WP_000004488.1.4415 WP_000004488.1.44162 WP_000004488.1.44165 WP_000004488.1.44166 WP_000004488.1.44201 WP_000004488.1.44203 WP_000004488.1.44211 WP_000004488.1.44222 WP_000004488.1.44238 WP_000004488.1.44264 WP_000004488.1.44273 WP_000004488.1.44285 WP_000004488.1.44287 WP_000004488.1.44292 WP_000004488.1.44314 WP_000004488.1.44324 WP_000004488.1.44354 WP_000004488.1.44365 WP_000004488.1.44389 WP_000004488.1.44394 WP_000004488.1.44424 WP_000004488.1.44426 WP_000004488.1.44445 WP_000004488.1.4445 WP_000004488.1.44458 WP_000004488.1.44461 WP_000004488.1.44488 WP_000004488.1.4449 WP_000004488.1.44524 WP_000004488.1.44539 WP_000004488.1.4454 WP_000004488.1.44558 WP_000004488.1.44561 WP_000004488.1.44570 WP_000004488.1.44587 WP_000004488.1.44608 WP_000004488.1.44610 WP_000004488.1.44627 WP_000004488.1.4463 WP_000004488.1.44642 WP_000004488.1.44649 WP_000004488.1.44668 WP_000004488.1.44671 WP_000004488.1.44686 WP_000004488.1.4471 WP_000004488.1.44724 WP_000004488.1.4473 WP_000004488.1.44733 WP_000004488.1.44756 WP_000004488.1.44784 WP_000004488.1.448 WP_000004488.1.44814 WP_000004488.1.44818 WP_000004488.1.44821 WP_000004488.1.44840 WP_000004488.1.44848 WP_000004488.1.44849 WP_000004488.1.44854 WP_000004488.1.44857 WP_000004488.1.44906 WP_000004488.1.44923 WP_000004488.1.44954 WP_000004488.1.44960 WP_000004488.1.44961 WP_000004488.1.44970 WP_000004488.1.44975 WP_000004488.1.44980 WP_000004488.1.45000 WP_000004488.1.45020 WP_000004488.1.45025 WP_000004488.1.45028 WP_000004488.1.45043 WP_000004488.1.45053 WP_000004488.1.45068 WP_000004488.1.45076 WP_000004488.1.45116 WP_000004488.1.45153 WP_000004488.1.45156 WP_000004488.1.4516 WP_000004488.1.45195 WP_000004488.1.45208 WP_000004488.1.4524 WP_000004488.1.45246 WP_000004488.1.45293 WP_000004488.1.45301 WP_000004488.1.45313 WP_000004488.1.45329 WP_000004488.1.4535 WP_000004488.1.45359 WP_000004488.1.4538 WP_000004488.1.45392 WP_000004488.1.45404 WP_000004488.1.45444 WP_000004488.1.45486 WP_000004488.1.4549 WP_000004488.1.45494 WP_000004488.1.45500 WP_000004488.1.45538 WP_000004488.1.45575 WP_000004488.1.45581 WP_000004488.1.45595 WP_000004488.1.45600 WP_000004488.1.4563 WP_000004488.1.45664 WP_000004488.1.45674 WP_000004488.1.4570 WP_000004488.1.45707 WP_000004488.1.45718 WP_000004488.1.4574 WP_000004488.1.45741 WP_000004488.1.45752 WP_000004488.1.45799 WP_000004488.1.45840 WP_000004488.1.45841 WP_000004488.1.45846 WP_000004488.1.45865 WP_000004488.1.45868 WP_000004488.1.45901 WP_000004488.1.4593 WP_000004488.1.45930 WP_000004488.1.45931 WP_000004488.1.45933 WP_000004488.1.45941 WP_000004488.1.45945 WP_000004488.1.45949 WP_000004488.1.45960 WP_000004488.1.45962 WP_000004488.1.45968 WP_000004488.1.45991 WP_000004488.1.4600 WP_000004488.1.46026 WP_000004488.1.46027 WP_000004488.1.46039 WP_000004488.1.46048 WP_000004488.1.46049 WP_000004488.1.46070 WP_000004488.1.46081 WP_000004488.1.46097 WP_000004488.1.46105 WP_000004488.1.46115 WP_000004488.1.46122 WP_000004488.1.4613 WP_000004488.1.4617 WP_000004488.1.46186 WP_000004488.1.4619 WP_000004488.1.46197 WP_000004488.1.46213 WP_000004488.1.46239 WP_000004488.1.46245 WP_000004488.1.46257 WP_000004488.1.46282 WP_000004488.1.46283 WP_000004488.1.46301 WP_000004488.1.46325 WP_000004488.1.46329 WP_000004488.1.46369 WP_000004488.1.46379 WP_000004488.1.46414 WP_000004488.1.46429 WP_000004488.1.4643 WP_000004488.1.46433 WP_000004488.1.46441 WP_000004488.1.46451 WP_000004488.1.4646 WP_000004488.1.46468 WP_000004488.1.46477 WP_000004488.1.46503 WP_000004488.1.46526 WP_000004488.1.46531 WP_000004488.1.46541 WP_000004488.1.46552 WP_000004488.1.46555 WP_000004488.1.4657 WP_000004488.1.46573 WP_000004488.1.46582 WP_000004488.1.46594 WP_000004488.1.46597 WP_000004488.1.46602 WP_000004488.1.46611 WP_000004488.1.46614 WP_000004488.1.46616 WP_000004488.1.46626 WP_000004488.1.46643 WP_000004488.1.46655 WP_000004488.1.46668 WP_000004488.1.4670 WP_000004488.1.46734 WP_000004488.1.46743 WP_000004488.1.46802 WP_000004488.1.46810 WP_000004488.1.46820 WP_000004488.1.46821 WP_000004488.1.46832 WP_000004488.1.46841 WP_000004488.1.46857 WP_000004488.1.46860 WP_000004488.1.46876 WP_000004488.1.46882 WP_000004488.1.46898 WP_000004488.1.46909 WP_000004488.1.4691 WP_000004488.1.46912 WP_000004488.1.46913 WP_000004488.1.46932 WP_000004488.1.46990 WP_000004488.1.46994 WP_000004488.1.46999 WP_000004488.1.47028 WP_000004488.1.47030 WP_000004488.1.47034 WP_000004488.1.47038 WP_000004488.1.47048 WP_000004488.1.47050 WP_000004488.1.47063 WP_000004488.1.47069 WP_000004488.1.47073 WP_000004488.1.4708 WP_000004488.1.47135 WP_000004488.1.47140 WP_000004488.1.47156 WP_000004488.1.47167 WP_000004488.1.47186 WP_000004488.1.47198 WP_000004488.1.4722 WP_000004488.1.47224 WP_000004488.1.4723 WP_000004488.1.47246 WP_000004488.1.47247 WP_000004488.1.47280 WP_000004488.1.47307 WP_000004488.1.47316 WP_000004488.1.47319 WP_000004488.1.47322 WP_000004488.1.47332 WP_000004488.1.47350 WP_000004488.1.47356 WP_000004488.1.47363 WP_000004488.1.47370 WP_000004488.1.47386 WP_000004488.1.47398 WP_000004488.1.4740 WP_000004488.1.47401 WP_000004488.1.47411 WP_000004488.1.47414 WP_000004488.1.47416 WP_000004488.1.47425 WP_000004488.1.47451 WP_000004488.1.47464 WP_000004488.1.47473 WP_000004488.1.47477 WP_000004488.1.47496 WP_000004488.1.47500 WP_000004488.1.47529 WP_000004488.1.47546 WP_000004488.1.47555 WP_000004488.1.47582 WP_000004488.1.47599 WP_000004488.1.47634 WP_000004488.1.47646 WP_000004488.1.47662 WP_000004488.1.47673 WP_000004488.1.4772 WP_000004488.1.47722 WP_000004488.1.4773 WP_000004488.1.47734 WP_000004488.1.47740 WP_000004488.1.47744 WP_000004488.1.47764 WP_000004488.1.47765 WP_000004488.1.47770 WP_000004488.1.47775 WP_000004488.1.47784 WP_000004488.1.47790 WP_000004488.1.47791 WP_000004488.1.47820 WP_000004488.1.47827 WP_000004488.1.47848 WP_000004488.1.4785 WP_000004488.1.47884 WP_000004488.1.47914 WP_000004488.1.47954 WP_000004488.1.4796 WP_000004488.1.47962 WP_000004488.1.47976 WP_000004488.1.47981 WP_000004488.1.47983 WP_000004488.1.47994 WP_000004488.1.48000 WP_000004488.1.48018 WP_000004488.1.48029 WP_000004488.1.48040 WP_000004488.1.48048 WP_000004488.1.48065 WP_000004488.1.48077 WP_000004488.1.48080 WP_000004488.1.48087 WP_000004488.1.48090 WP_000004488.1.48096 WP_000004488.1.4811 WP_000004488.1.48111 WP_000004488.1.4812 WP_000004488.1.48144 WP_000004488.1.48168 WP_000004488.1.48176 WP_000004488.1.48194 WP_000004488.1.48203 WP_000004488.1.48216 WP_000004488.1.48222 WP_000004488.1.48226 WP_000004488.1.48258 WP_000004488.1.48285 WP_000004488.1.48290 WP_000004488.1.48291 WP_000004488.1.48353 WP_000004488.1.48355 WP_000004488.1.48371 WP_000004488.1.48404 WP_000004488.1.48417 WP_000004488.1.48421 WP_000004488.1.48433 WP_000004488.1.48477 WP_000004488.1.48480 WP_000004488.1.48483 WP_000004488.1.48505 WP_000004488.1.48522 WP_000004488.1.4857 WP_000004488.1.48571 WP_000004488.1.48590 WP_000004488.1.486 WP_000004488.1.48602 WP_000004488.1.48615 WP_000004488.1.48626 WP_000004488.1.48678 WP_000004488.1.48689 WP_000004488.1.48697 WP_000004488.1.4871 WP_000004488.1.48712 WP_000004488.1.4876 WP_000004488.1.48771 WP_000004488.1.48792 WP_000004488.1.48801 WP_000004488.1.48806 WP_000004488.1.48825 WP_000004488.1.48847 WP_000004488.1.48860 WP_000004488.1.48901 WP_000004488.1.48907 WP_000004488.1.48921 WP_000004488.1.48926 WP_000004488.1.48928 WP_000004488.1.48953 WP_000004488.1.48954 WP_000004488.1.48974 WP_000004488.1.49009 WP_000004488.1.49076 WP_000004488.1.49104 WP_000004488.1.49107 WP_000004488.1.49124 WP_000004488.1.49136 WP_000004488.1.49147 WP_000004488.1.49190 WP_000004488.1.49229 WP_000004488.1.49236 WP_000004488.1.49243 WP_000004488.1.49259 WP_000004488.1.4931 WP_000004488.1.49312 WP_000004488.1.49321 WP_000004488.1.49332 WP_000004488.1.49336 WP_000004488.1.49363 WP_000004488.1.49401 WP_000004488.1.49431 WP_000004488.1.49459 WP_000004488.1.49464 WP_000004488.1.49481 WP_000004488.1.49482 WP_000004488.1.4949 WP_000004488.1.49496 WP_000004488.1.49528 WP_000004488.1.4953 WP_000004488.1.49531 WP_000004488.1.49537 WP_000004488.1.49546 WP_000004488.1.49558 WP_000004488.1.49567 WP_000004488.1.49599 WP_000004488.1.49621 WP_000004488.1.49645 WP_000004488.1.49655 WP_000004488.1.49661 WP_000004488.1.49684 WP_000004488.1.497 WP_000004488.1.49712 WP_000004488.1.49722 WP_000004488.1.49733 WP_000004488.1.49740 WP_000004488.1.49747 WP_000004488.1.49768 WP_000004488.1.49771 WP_000004488.1.49774 WP_000004488.1.49777 WP_000004488.1.49788 WP_000004488.1.49823 WP_000004488.1.49856 WP_000004488.1.49861 WP_000004488.1.49879 WP_000004488.1.49883 WP_000004488.1.49900 WP_000004488.1.49902 WP_000004488.1.49950 WP_000004488.1.49954 WP_000004488.1.49987 WP_000004488.1.50006 WP_000004488.1.50008 WP_000004488.1.5003 WP_000004488.1.50036 WP_000004488.1.50078 WP_000004488.1.50098 WP_000004488.1.50110 WP_000004488.1.50113 WP_000004488.1.50119 WP_000004488.1.50136 WP_000004488.1.50146 WP_000004488.1.5017 WP_000004488.1.50179 WP_000004488.1.50182 WP_000004488.1.50187 WP_000004488.1.50191 WP_000004488.1.50196 WP_000004488.1.50207 WP_000004488.1.50230 WP_000004488.1.50258 WP_000004488.1.50262 WP_000004488.1.50266 WP_000004488.1.50269 WP_000004488.1.50273 WP_000004488.1.50304 WP_000004488.1.50329 WP_000004488.1.50345 WP_000004488.1.50353 WP_000004488.1.50358 WP_000004488.1.50361 WP_000004488.1.50366 WP_000004488.1.5037 WP_000004488.1.50380 WP_000004488.1.50381 WP_000004488.1.5040 WP_000004488.1.5041 WP_000004488.1.50412 WP_000004488.1.50418 WP_000004488.1.50427 WP_000004488.1.50452 WP_000004488.1.5046 WP_000004488.1.50539 WP_000004488.1.50548 WP_000004488.1.50549 WP_000004488.1.5056 WP_000004488.1.50564 WP_000004488.1.50579 WP_000004488.1.506 WP_000004488.1.5061 WP_000004488.1.50616 WP_000004488.1.5064 WP_000004488.1.5067 WP_000004488.1.50715 WP_000004488.1.50717 WP_000004488.1.50725 WP_000004488.1.50728 WP_000004488.1.50762 WP_000004488.1.50936 WP_000004488.1.50939 WP_000004488.1.50947 WP_000004488.1.50969 WP_000004488.1.50986 WP_000004488.1.50993 WP_000004488.1.50996 WP_000004488.1.51013 WP_000004488.1.51027 WP_000004488.1.51042 WP_000004488.1.5106 WP_000004488.1.51109 WP_000004488.1.51127 WP_000004488.1.51154 WP_000004488.1.51171 WP_000004488.1.51172 WP_000004488.1.51175 WP_000004488.1.51201 WP_000004488.1.51206 WP_000004488.1.51248 WP_000004488.1.51255 WP_000004488.1.51260 WP_000004488.1.51278 WP_000004488.1.5128 WP_000004488.1.51283 WP_000004488.1.51299 WP_000004488.1.51300 WP_000004488.1.51307 WP_000004488.1.51320 WP_000004488.1.51323 WP_000004488.1.51325 WP_000004488.1.51330 WP_000004488.1.51336 WP_000004488.1.51354 WP_000004488.1.51360 WP_000004488.1.51364 WP_000004488.1.51380 WP_000004488.1.51405 WP_000004488.1.51425 WP_000004488.1.51427 WP_000004488.1.51430 WP_000004488.1.51441 WP_000004488.1.5146 WP_000004488.1.51462 WP_000004488.1.51482 WP_000004488.1.51490 WP_000004488.1.51495 WP_000004488.1.51503 WP_000004488.1.51505 WP_000004488.1.51513 WP_000004488.1.51525 WP_000004488.1.51537 WP_000004488.1.51539 WP_000004488.1.51542 WP_000004488.1.51548 WP_000004488.1.51552 WP_000004488.1.5157 WP_000004488.1.51580 WP_000004488.1.51587 WP_000004488.1.51600 WP_000004488.1.51607 WP_000004488.1.51624 WP_000004488.1.51629 WP_000004488.1.51643 WP_000004488.1.51662 WP_000004488.1.51690 WP_000004488.1.51693 WP_000004488.1.51707 WP_000004488.1.5172 WP_000004488.1.51736 WP_000004488.1.51760 WP_000004488.1.51784 WP_000004488.1.51834 WP_000004488.1.51837 WP_000004488.1.51839 WP_000004488.1.51869 WP_000004488.1.51873 WP_000004488.1.51899 WP_000004488.1.51906 WP_000004488.1.51949 WP_000004488.1.51968 WP_000004488.1.51979 WP_000004488.1.51985 WP_000004488.1.51988 WP_000004488.1.51999 WP_000004488.1.52002 WP_000004488.1.52011 WP_000004488.1.52020 WP_000004488.1.52039 WP_000004488.1.52044 WP_000004488.1.52062 WP_000004488.1.52076 WP_000004488.1.52111 WP_000004488.1.52126 WP_000004488.1.52127 WP_000004488.1.5217 WP_000004488.1.52171 WP_000004488.1.52186 WP_000004488.1.52200 WP_000004488.1.52211 WP_000004488.1.52213 WP_000004488.1.52214 WP_000004488.1.52225 WP_000004488.1.52230 WP_000004488.1.52236 WP_000004488.1.52240 WP_000004488.1.52243 WP_000004488.1.52249 WP_000004488.1.52257 WP_000004488.1.5227 WP_000004488.1.52270 WP_000004488.1.52272 WP_000004488.1.52304 WP_000004488.1.52305 WP_000004488.1.52313 WP_000004488.1.52324 WP_000004488.1.52328 WP_000004488.1.52378 WP_000004488.1.5239 WP_000004488.1.52399 WP_000004488.1.52406 WP_000004488.1.52413 WP_000004488.1.52419 WP_000004488.1.52421 WP_000004488.1.52492 WP_000004488.1.52496 WP_000004488.1.52543 WP_000004488.1.52544 WP_000004488.1.52554 WP_000004488.1.52558 WP_000004488.1.52567 WP_000004488.1.52568 WP_000004488.1.52601 WP_000004488.1.5265 WP_000004488.1.52662 WP_000004488.1.52691 WP_000004488.1.52710 WP_000004488.1.5272 WP_000004488.1.52735 WP_000004488.1.52755 WP_000004488.1.52762 WP_000004488.1.52771 WP_000004488.1.52774 WP_000004488.1.52777 WP_000004488.1.52780 WP_000004488.1.52781 WP_000004488.1.52801 WP_000004488.1.52844 WP_000004488.1.52852 WP_000004488.1.52853 WP_000004488.1.52855 WP_000004488.1.52881 WP_000004488.1.52883 WP_000004488.1.52895 WP_000004488.1.52908 WP_000004488.1.5291 WP_000004488.1.52913 WP_000004488.1.52933 WP_000004488.1.52942 WP_000004488.1.52962 WP_000004488.1.52995 WP_000004488.1.52996 WP_000004488.1.53012 WP_000004488.1.53020 WP_000004488.1.53027 WP_000004488.1.53065 WP_000004488.1.53084 WP_000004488.1.53099 WP_000004488.1.5310 WP_000004488.1.53110 WP_000004488.1.53155 WP_000004488.1.53181 WP_000004488.1.53186 WP_000004488.1.532 WP_000004488.1.53211 WP_000004488.1.53223 WP_000004488.1.53228 WP_000004488.1.53238 WP_000004488.1.53242 WP_000004488.1.53244 WP_000004488.1.53251 WP_000004488.1.53252 WP_000004488.1.53262 WP_000004488.1.53270 WP_000004488.1.53277 WP_000004488.1.53308 WP_000004488.1.53327 WP_000004488.1.53356 WP_000004488.1.53360 WP_000004488.1.53364 WP_000004488.1.53377 WP_000004488.1.53401 WP_000004488.1.53419 WP_000004488.1.5342 WP_000004488.1.53428 WP_000004488.1.53431 WP_000004488.1.53482 WP_000004488.1.53505 WP_000004488.1.5351 WP_000004488.1.53535 WP_000004488.1.53537 WP_000004488.1.53545 WP_000004488.1.53556 WP_000004488.1.53574 WP_000004488.1.53582 WP_000004488.1.53589 WP_000004488.1.53592 WP_000004488.1.53594 WP_000004488.1.5362 WP_000004488.1.53642 WP_000004488.1.53645 WP_000004488.1.53706 WP_000004488.1.53769 WP_000004488.1.53809 WP_000004488.1.53811 WP_000004488.1.53863 WP_000004488.1.53866 WP_000004488.1.53878 WP_000004488.1.53884 WP_000004488.1.53931 WP_000004488.1.5395 WP_000004488.1.53966 WP_000004488.1.53968 WP_000004488.1.53972 WP_000004488.1.53978 WP_000004488.1.53991 WP_000004488.1.53994 WP_000004488.1.54002 WP_000004488.1.54013 WP_000004488.1.54023 WP_000004488.1.54024 WP_000004488.1.54028 WP_000004488.1.54032 WP_000004488.1.54072 WP_000004488.1.54091 WP_000004488.1.54104 WP_000004488.1.54144 WP_000004488.1.54169 WP_000004488.1.54185 WP_000004488.1.54202 WP_000004488.1.54213 WP_000004488.1.54307 WP_000004488.1.54317 WP_000004488.1.54328 WP_000004488.1.54329 WP_000004488.1.5433 WP_000004488.1.54344 WP_000004488.1.54359 WP_000004488.1.5440 WP_000004488.1.5441 WP_000004488.1.54411 WP_000004488.1.54429 WP_000004488.1.54454 WP_000004488.1.54463 WP_000004488.1.54476 WP_000004488.1.54507 WP_000004488.1.54546 WP_000004488.1.54585 WP_000004488.1.54591 WP_000004488.1.5460 WP_000004488.1.54601 WP_000004488.1.54602 WP_000004488.1.54605 WP_000004488.1.5461 WP_000004488.1.54614 WP_000004488.1.54620 WP_000004488.1.54625 WP_000004488.1.54638 WP_000004488.1.54641 WP_000004488.1.54643 WP_000004488.1.5467 WP_000004488.1.54688 WP_000004488.1.54695 WP_000004488.1.5470 WP_000004488.1.54708 WP_000004488.1.54725 WP_000004488.1.54729 WP_000004488.1.54755 WP_000004488.1.54760 WP_000004488.1.54769 WP_000004488.1.5479 WP_000004488.1.54798 WP_000004488.1.54829 WP_000004488.1.5486 WP_000004488.1.54883 WP_000004488.1.54918 WP_000004488.1.54921 WP_000004488.1.54946 WP_000004488.1.54972 WP_000004488.1.54981 WP_000004488.1.54989 WP_000004488.1.54991 WP_000004488.1.54993 WP_000004488.1.55003 WP_000004488.1.55005 WP_000004488.1.55009 WP_000004488.1.55041 WP_000004488.1.55070 WP_000004488.1.55112 WP_000004488.1.55115 WP_000004488.1.55123 WP_000004488.1.55134 WP_000004488.1.55144 WP_000004488.1.55151 WP_000004488.1.55177 WP_000004488.1.55197 WP_000004488.1.5520 WP_000004488.1.55203 WP_000004488.1.55218 WP_000004488.1.55222 WP_000004488.1.55275 WP_000004488.1.55286 WP_000004488.1.55338 WP_000004488.1.55342 WP_000004488.1.55357 WP_000004488.1.55381 WP_000004488.1.55417 WP_000004488.1.55424 WP_000004488.1.55425 WP_000004488.1.55466 WP_000004488.1.55482 WP_000004488.1.55483 WP_000004488.1.55492 WP_000004488.1.55507 WP_000004488.1.55529 WP_000004488.1.55551 WP_000004488.1.55552 WP_000004488.1.55556 WP_000004488.1.55560 WP_000004488.1.55563 WP_000004488.1.55571 WP_000004488.1.55574 WP_000004488.1.55581 WP_000004488.1.55597 WP_000004488.1.55608 WP_000004488.1.5561 WP_000004488.1.55629 WP_000004488.1.5566 WP_000004488.1.55676 WP_000004488.1.5570 WP_000004488.1.55709 WP_000004488.1.55720 WP_000004488.1.55727 WP_000004488.1.55730 WP_000004488.1.55757 WP_000004488.1.55787 WP_000004488.1.55820 WP_000004488.1.55825 WP_000004488.1.55838 WP_000004488.1.55844 WP_000004488.1.55868 WP_000004488.1.55892 WP_000004488.1.55897 WP_000004488.1.55979 WP_000004488.1.55988 WP_000004488.1.56072 WP_000004488.1.56101 WP_000004488.1.5614 WP_000004488.1.56149 WP_000004488.1.56151 WP_000004488.1.5616 WP_000004488.1.56164 WP_000004488.1.56169 WP_000004488.1.56177 WP_000004488.1.56193 WP_000004488.1.56197 WP_000004488.1.56216 WP_000004488.1.56231 WP_000004488.1.56285 WP_000004488.1.56293 WP_000004488.1.56302 WP_000004488.1.56345 WP_000004488.1.56358 WP_000004488.1.56371 WP_000004488.1.56388 WP_000004488.1.5639 WP_000004488.1.56390 WP_000004488.1.56392 WP_000004488.1.56399 WP_000004488.1.56436 WP_000004488.1.56439 WP_000004488.1.56446 WP_000004488.1.5646 WP_000004488.1.56481 WP_000004488.1.56489 WP_000004488.1.5649 WP_000004488.1.56491 WP_000004488.1.56513 WP_000004488.1.56543 WP_000004488.1.56554 WP_000004488.1.56571 WP_000004488.1.56573 WP_000004488.1.56586 WP_000004488.1.56665 WP_000004488.1.56680 WP_000004488.1.56689 WP_000004488.1.5670 WP_000004488.1.56704 WP_000004488.1.56713 WP_000004488.1.56721 WP_000004488.1.56776 WP_000004488.1.56777 WP_000004488.1.56786 WP_000004488.1.56787 WP_000004488.1.56789 WP_000004488.1.56799 WP_000004488.1.56835 WP_000004488.1.56846 WP_000004488.1.5685 WP_000004488.1.56871 WP_000004488.1.56882 WP_000004488.1.56908 WP_000004488.1.56932 WP_000004488.1.56934 WP_000004488.1.56937 WP_000004488.1.56951 WP_000004488.1.56978 WP_000004488.1.56980 WP_000004488.1.56992 WP_000004488.1.57032 WP_000004488.1.57068 WP_000004488.1.57071 WP_000004488.1.57072 WP_000004488.1.57086 WP_000004488.1.57100 WP_000004488.1.57124 WP_000004488.1.57150 WP_000004488.1.57180 WP_000004488.1.57181 WP_000004488.1.57182 WP_000004488.1.57197 WP_000004488.1.57216 WP_000004488.1.57222 WP_000004488.1.57254 WP_000004488.1.57269 WP_000004488.1.57280 WP_000004488.1.57281 WP_000004488.1.57319 WP_000004488.1.57348 WP_000004488.1.57386 WP_000004488.1.57395 WP_000004488.1.57401 WP_000004488.1.57403 WP_000004488.1.57410 WP_000004488.1.57414 WP_000004488.1.57432 WP_000004488.1.57438 WP_000004488.1.57453 WP_000004488.1.57466 WP_000004488.1.5748 WP_000004488.1.57487 WP_000004488.1.57538 WP_000004488.1.5755 WP_000004488.1.57550 WP_000004488.1.57558 WP_000004488.1.57574 WP_000004488.1.57588 WP_000004488.1.57610 WP_000004488.1.57628 WP_000004488.1.57629 WP_000004488.1.57634 WP_000004488.1.57638 WP_000004488.1.5764 WP_000004488.1.57646 WP_000004488.1.57659 WP_000004488.1.57663 WP_000004488.1.57719 WP_000004488.1.57738 WP_000004488.1.57812 WP_000004488.1.57836 WP_000004488.1.57846 WP_000004488.1.57851 WP_000004488.1.5786 WP_000004488.1.57898 WP_000004488.1.57903 WP_000004488.1.57904 WP_000004488.1.57920 WP_000004488.1.57951 WP_000004488.1.57975 WP_000004488.1.57982 WP_000004488.1.57983 WP_000004488.1.57994 WP_000004488.1.58001 WP_000004488.1.58022 WP_000004488.1.58045 WP_000004488.1.58048 WP_000004488.1.58057 WP_000004488.1.58060 WP_000004488.1.58080 WP_000004488.1.58098 WP_000004488.1.5810 WP_000004488.1.58136 WP_000004488.1.58143 WP_000004488.1.58146 WP_000004488.1.58163 WP_000004488.1.58169 WP_000004488.1.58172 WP_000004488.1.58206 WP_000004488.1.58226 WP_000004488.1.58232 WP_000004488.1.58238 WP_000004488.1.58244 WP_000004488.1.58267 WP_000004488.1.58289 WP_000004488.1.58336 WP_000004488.1.58368 WP_000004488.1.58371 WP_000004488.1.58384 WP_000004488.1.584 WP_000004488.1.58401 WP_000004488.1.5842 WP_000004488.1.58420 WP_000004488.1.58423 WP_000004488.1.58429 WP_000004488.1.58440 WP_000004488.1.58444 WP_000004488.1.58475 WP_000004488.1.58484 WP_000004488.1.58493 WP_000004488.1.58496 WP_000004488.1.58507 WP_000004488.1.58514 WP_000004488.1.5852 WP_000004488.1.58528 WP_000004488.1.58547 WP_000004488.1.58560 WP_000004488.1.58572 WP_000004488.1.58582 WP_000004488.1.58622 WP_000004488.1.58680 WP_000004488.1.58705 WP_000004488.1.58707 WP_000004488.1.58723 WP_000004488.1.58799 WP_000004488.1.58837 WP_000004488.1.58867 WP_000004488.1.58870 WP_000004488.1.58940 WP_000004488.1.58942 WP_000004488.1.58951 WP_000004488.1.58958 WP_000004488.1.58976 WP_000004488.1.58977 WP_000004488.1.58983 WP_000004488.1.58999 WP_000004488.1.59024 WP_000004488.1.59026 WP_000004488.1.59035 WP_000004488.1.59038 WP_000004488.1.59047 WP_000004488.1.5906 WP_000004488.1.59083 WP_000004488.1.59119 WP_000004488.1.59165 WP_000004488.1.59174 WP_000004488.1.59190 WP_000004488.1.59199 WP_000004488.1.59218 WP_000004488.1.59226 WP_000004488.1.59263 WP_000004488.1.59280 WP_000004488.1.59293 WP_000004488.1.59306 WP_000004488.1.59359 WP_000004488.1.59374 WP_000004488.1.59395 WP_000004488.1.59396 WP_000004488.1.59407 WP_000004488.1.59413 WP_000004488.1.59423 WP_000004488.1.59434 WP_000004488.1.59470 WP_000004488.1.59491 WP_000004488.1.59513 WP_000004488.1.59533 WP_000004488.1.59553 WP_000004488.1.59577 WP_000004488.1.59590 WP_000004488.1.59615 WP_000004488.1.59621 WP_000004488.1.5963 WP_000004488.1.59638 WP_000004488.1.5965 WP_000004488.1.59679 WP_000004488.1.59689 WP_000004488.1.59699 WP_000004488.1.597 WP_000004488.1.59717 WP_000004488.1.59730 WP_000004488.1.59733 WP_000004488.1.59737 WP_000004488.1.59748 WP_000004488.1.59756 WP_000004488.1.59781 WP_000004488.1.59782 WP_000004488.1.59788 WP_000004488.1.59823 WP_000004488.1.59836 WP_000004488.1.59838 WP_000004488.1.59853 WP_000004488.1.59855 WP_000004488.1.59877 WP_000004488.1.5990 WP_000004488.1.59905 WP_000004488.1.59912 WP_000004488.1.59914 WP_000004488.1.59931 WP_000004488.1.59932 WP_000004488.1.59959 WP_000004488.1.59998 WP_000004488.1.60005 WP_000004488.1.6002 WP_000004488.1.60031 WP_000004488.1.60042 WP_000004488.1.60043 WP_000004488.1.60048 WP_000004488.1.60067 WP_000004488.1.60070 WP_000004488.1.60095 WP_000004488.1.60110 WP_000004488.1.60117 WP_000004488.1.6013 WP_000004488.1.60151 WP_000004488.1.60186 WP_000004488.1.6022 WP_000004488.1.60225 WP_000004488.1.60228 WP_000004488.1.60246 WP_000004488.1.60304 WP_000004488.1.60325 WP_000004488.1.60337 WP_000004488.1.60342 WP_000004488.1.60343 WP_000004488.1.60374 WP_000004488.1.60387 WP_000004488.1.60436 WP_000004488.1.60443 WP_000004488.1.60457 WP_000004488.1.60461 WP_000004488.1.60477 WP_000004488.1.60491 WP_000004488.1.60498 WP_000004488.1.60550 WP_000004488.1.60559 WP_000004488.1.60570 WP_000004488.1.60576 WP_000004488.1.6059 WP_000004488.1.60599 WP_000004488.1.60606 WP_000004488.1.6061 WP_000004488.1.60613 WP_000004488.1.60614 WP_000004488.1.6064 WP_000004488.1.60644 WP_000004488.1.60647 WP_000004488.1.6066 WP_000004488.1.60671 WP_000004488.1.6068 WP_000004488.1.60684 WP_000004488.1.60698 WP_000004488.1.60717 WP_000004488.1.60732 WP_000004488.1.60744 WP_000004488.1.60761 WP_000004488.1.60771 WP_000004488.1.60805 WP_000004488.1.60816 WP_000004488.1.60826 WP_000004488.1.60835 WP_000004488.1.60847 WP_000004488.1.60872 WP_000004488.1.60895 WP_000004488.1.60901 WP_000004488.1.60921 WP_000004488.1.60925 WP_000004488.1.60927 WP_000004488.1.60935 WP_000004488.1.6094 WP_000004488.1.60974 WP_000004488.1.61005 WP_000004488.1.61006 WP_000004488.1.61035 WP_000004488.1.61039 WP_000004488.1.61058 WP_000004488.1.61096 WP_000004488.1.61099 WP_000004488.1.6110 WP_000004488.1.61102 WP_000004488.1.61108 WP_000004488.1.61112 WP_000004488.1.61132 WP_000004488.1.61148 WP_000004488.1.61170 WP_000004488.1.61174 WP_000004488.1.61175 WP_000004488.1.61181 WP_000004488.1.61183 WP_000004488.1.61186 WP_000004488.1.61223 WP_000004488.1.61225 WP_000004488.1.61241 WP_000004488.1.61253 WP_000004488.1.61268 WP_000004488.1.61284 WP_000004488.1.61292 WP_000004488.1.61360 WP_000004488.1.61362 WP_000004488.1.61364 WP_000004488.1.61373 WP_000004488.1.61398 WP_000004488.1.61480 WP_000004488.1.61496 WP_000004488.1.61505 WP_000004488.1.61512 WP_000004488.1.61517 WP_000004488.1.61524 WP_000004488.1.61551 WP_000004488.1.61612 WP_000004488.1.61623 WP_000004488.1.61636 WP_000004488.1.61643 WP_000004488.1.61663 WP_000004488.1.61703 WP_000004488.1.61718 WP_000004488.1.61758 WP_000004488.1.61770 WP_000004488.1.61772 WP_000004488.1.61779 WP_000004488.1.618 WP_000004488.1.61822 WP_000004488.1.61853 WP_000004488.1.61858 WP_000004488.1.61874 WP_000004488.1.61893 WP_000004488.1.61926 WP_000004488.1.61939 WP_000004488.1.61948 WP_000004488.1.61949 WP_000004488.1.61957 WP_000004488.1.61966 WP_000004488.1.61985 WP_000004488.1.62041 WP_000004488.1.62099 WP_000004488.1.6212 WP_000004488.1.62135 WP_000004488.1.62182 WP_000004488.1.62264 WP_000004488.1.62266 WP_000004488.1.62273 WP_000004488.1.62282 WP_000004488.1.62290 WP_000004488.1.62296 WP_000004488.1.62303 WP_000004488.1.62337 WP_000004488.1.62348 WP_000004488.1.62358 WP_000004488.1.62424 WP_000004488.1.62447 WP_000004488.1.6245 WP_000004488.1.62460 WP_000004488.1.62480 WP_000004488.1.62487 WP_000004488.1.62507 WP_000004488.1.62513 WP_000004488.1.62514 WP_000004488.1.62529 WP_000004488.1.62541 WP_000004488.1.6261 WP_000004488.1.62612 WP_000004488.1.62631 WP_000004488.1.62642 WP_000004488.1.62646 WP_000004488.1.62668 WP_000004488.1.62675 WP_000004488.1.62681 WP_000004488.1.62735 WP_000004488.1.62750 WP_000004488.1.62762 WP_000004488.1.62787 WP_000004488.1.62802 WP_000004488.1.62812 WP_000004488.1.62818 WP_000004488.1.62840 WP_000004488.1.62843 WP_000004488.1.62850 WP_000004488.1.62851 WP_000004488.1.62888 WP_000004488.1.62919 WP_000004488.1.6293 WP_000004488.1.62931 WP_000004488.1.62959 WP_000004488.1.62973 WP_000004488.1.62989 WP_000004488.1.6299 WP_000004488.1.62992 WP_000004488.1.63023 WP_000004488.1.6307 WP_000004488.1.63078 WP_000004488.1.63113 WP_000004488.1.63167 WP_000004488.1.63177 WP_000004488.1.63189 WP_000004488.1.63246 WP_000004488.1.6331 WP_000004488.1.63330 WP_000004488.1.6334 WP_000004488.1.63350 WP_000004488.1.6337 WP_000004488.1.63370 WP_000004488.1.63374 WP_000004488.1.63393 WP_000004488.1.63435 WP_000004488.1.63437 WP_000004488.1.63445 WP_000004488.1.63453 WP_000004488.1.63466 WP_000004488.1.63467 WP_000004488.1.63470 WP_000004488.1.63478 WP_000004488.1.63484 WP_000004488.1.63487 WP_000004488.1.63491 WP_000004488.1.63536 WP_000004488.1.63554 WP_000004488.1.63556 WP_000004488.1.63563 WP_000004488.1.63576 WP_000004488.1.63586 WP_000004488.1.63602 WP_000004488.1.63604 WP_000004488.1.63608 WP_000004488.1.63612 WP_000004488.1.63615 WP_000004488.1.6364 WP_000004488.1.63666 WP_000004488.1.63679 WP_000004488.1.63683 WP_000004488.1.63703 WP_000004488.1.63721 WP_000004488.1.63746 WP_000004488.1.63800 WP_000004488.1.63810 WP_000004488.1.63821 WP_000004488.1.63856 WP_000004488.1.63871 WP_000004488.1.63872 WP_000004488.1.63957 WP_000004488.1.63969 WP_000004488.1.63990 WP_000004488.1.64008 WP_000004488.1.64014 WP_000004488.1.64040 WP_000004488.1.64045 WP_000004488.1.64050 WP_000004488.1.64074 WP_000004488.1.64080 WP_000004488.1.64086 WP_000004488.1.64110 WP_000004488.1.64150 WP_000004488.1.64153 WP_000004488.1.6416 WP_000004488.1.64161 WP_000004488.1.64165 WP_000004488.1.64175 WP_000004488.1.64193 WP_000004488.1.64280 WP_000004488.1.64285 WP_000004488.1.64286 WP_000004488.1.6431 WP_000004488.1.64321 WP_000004488.1.64330 WP_000004488.1.64356 WP_000004488.1.64371 WP_000004488.1.64380 WP_000004488.1.64391 WP_000004488.1.6441 WP_000004488.1.64437 WP_000004488.1.64438 WP_000004488.1.64448 WP_000004488.1.6445 WP_000004488.1.64458 WP_000004488.1.6446 WP_000004488.1.64519 WP_000004488.1.64520 WP_000004488.1.64528 WP_000004488.1.64540 WP_000004488.1.64563 WP_000004488.1.64621 WP_000004488.1.64634 WP_000004488.1.64657 WP_000004488.1.6469 WP_000004488.1.64693 WP_000004488.1.64695 WP_000004488.1.647 WP_000004488.1.64707 WP_000004488.1.64746 WP_000004488.1.64749 WP_000004488.1.64784 WP_000004488.1.64789 WP_000004488.1.64793 WP_000004488.1.64821 WP_000004488.1.64866 WP_000004488.1.64881 WP_000004488.1.64895 WP_000004488.1.64901 WP_000004488.1.64912 WP_000004488.1.64926 WP_000004488.1.64930 WP_000004488.1.64939 WP_000004488.1.64946 WP_000004488.1.64970 WP_000004488.1.6499 WP_000004488.1.64990 WP_000004488.1.65023 WP_000004488.1.65035 WP_000004488.1.65056 WP_000004488.1.65061 WP_000004488.1.65084 WP_000004488.1.65097 WP_000004488.1.6511 WP_000004488.1.65110 WP_000004488.1.65118 WP_000004488.1.65135 WP_000004488.1.65151 WP_000004488.1.65155 WP_000004488.1.6516 WP_000004488.1.65179 WP_000004488.1.65192 WP_000004488.1.65194 WP_000004488.1.65256 WP_000004488.1.65271 WP_000004488.1.65296 WP_000004488.1.65305 WP_000004488.1.65306 WP_000004488.1.65353 WP_000004488.1.65364 WP_000004488.1.65370 WP_000004488.1.65372 WP_000004488.1.654 WP_000004488.1.65408 WP_000004488.1.65413 WP_000004488.1.65415 WP_000004488.1.65484 WP_000004488.1.65493 WP_000004488.1.6553 WP_000004488.1.65531 WP_000004488.1.65546 WP_000004488.1.65581 WP_000004488.1.65596 WP_000004488.1.65662 WP_000004488.1.65667 WP_000004488.1.65672 WP_000004488.1.65677 WP_000004488.1.65708 WP_000004488.1.65714 WP_000004488.1.65762 WP_000004488.1.6587 WP_000004488.1.65875 WP_000004488.1.65898 WP_000004488.1.65912 WP_000004488.1.65954 WP_000004488.1.65961 WP_000004488.1.65962 WP_000004488.1.65963 WP_000004488.1.65976 WP_000004488.1.65978 WP_000004488.1.65988 WP_000004488.1.6599 WP_000004488.1.66001 WP_000004488.1.66007 WP_000004488.1.66016 WP_000004488.1.66022 WP_000004488.1.66033 WP_000004488.1.6604 WP_000004488.1.66050 WP_000004488.1.66059 WP_000004488.1.6609 WP_000004488.1.66094 WP_000004488.1.66100 WP_000004488.1.66102 WP_000004488.1.66104 WP_000004488.1.66105 WP_000004488.1.66121 WP_000004488.1.66127 WP_000004488.1.66161 WP_000004488.1.66181 WP_000004488.1.66197 WP_000004488.1.6622 WP_000004488.1.66251 WP_000004488.1.66264 WP_000004488.1.66280 WP_000004488.1.66288 WP_000004488.1.66327 WP_000004488.1.66335 WP_000004488.1.6635 WP_000004488.1.66387 WP_000004488.1.66389 WP_000004488.1.66395 WP_000004488.1.66412 WP_000004488.1.66432 WP_000004488.1.66448 WP_000004488.1.6645 WP_000004488.1.66501 WP_000004488.1.66511 WP_000004488.1.66531 WP_000004488.1.6654 WP_000004488.1.66550 WP_000004488.1.66559 WP_000004488.1.66566 WP_000004488.1.66579 WP_000004488.1.66624 WP_000004488.1.66644 WP_000004488.1.6665 WP_000004488.1.66700 WP_000004488.1.66719 WP_000004488.1.66751 WP_000004488.1.66758 WP_000004488.1.66783 WP_000004488.1.66791 WP_000004488.1.66794 WP_000004488.1.66795 WP_000004488.1.66849 WP_000004488.1.66873 WP_000004488.1.66922 WP_000004488.1.66926 WP_000004488.1.66933 WP_000004488.1.66948 WP_000004488.1.66975 WP_000004488.1.66978 WP_000004488.1.6701 WP_000004488.1.67018 WP_000004488.1.67021 WP_000004488.1.67022 WP_000004488.1.67026 WP_000004488.1.67035 WP_000004488.1.6706 WP_000004488.1.67073 WP_000004488.1.67102 WP_000004488.1.67136 WP_000004488.1.67137 WP_000004488.1.67149 WP_000004488.1.67150 WP_000004488.1.67193 WP_000004488.1.67194 WP_000004488.1.67200 WP_000004488.1.67210 WP_000004488.1.67214 WP_000004488.1.6723 WP_000004488.1.67272 WP_000004488.1.67278 WP_000004488.1.67293 WP_000004488.1.6735 WP_000004488.1.67383 WP_000004488.1.67412 WP_000004488.1.67415 WP_000004488.1.67446 WP_000004488.1.67452 WP_000004488.1.67454 WP_000004488.1.67456 WP_000004488.1.67462 WP_000004488.1.67467 WP_000004488.1.67468 WP_000004488.1.67522 WP_000004488.1.67533 WP_000004488.1.67538 WP_000004488.1.67549 WP_000004488.1.67553 WP_000004488.1.67581 WP_000004488.1.67660 WP_000004488.1.67663 WP_000004488.1.67676 WP_000004488.1.67681 WP_000004488.1.67685 WP_000004488.1.6769 WP_000004488.1.67701 WP_000004488.1.67704 WP_000004488.1.67724 WP_000004488.1.67726 WP_000004488.1.67732 WP_000004488.1.67753 WP_000004488.1.67775 WP_000004488.1.67780 WP_000004488.1.67786 WP_000004488.1.67787 WP_000004488.1.67788 WP_000004488.1.678 WP_000004488.1.67802 WP_000004488.1.67810 WP_000004488.1.67841 WP_000004488.1.67853 WP_000004488.1.67861 WP_000004488.1.67901 WP_000004488.1.6793 WP_000004488.1.67938 WP_000004488.1.67971 WP_000004488.1.67975 WP_000004488.1.67984 WP_000004488.1.67990 WP_000004488.1.67999 WP_000004488.1.68008 WP_000004488.1.68011 WP_000004488.1.6802 WP_000004488.1.68025 WP_000004488.1.6803 WP_000004488.1.68039 WP_000004488.1.68053 WP_000004488.1.68067 WP_000004488.1.68069 WP_000004488.1.68070 WP_000004488.1.68079 WP_000004488.1.68096 WP_000004488.1.6810 WP_000004488.1.68108 WP_000004488.1.68126 WP_000004488.1.68138 WP_000004488.1.6814 WP_000004488.1.68145 WP_000004488.1.68170 WP_000004488.1.68175 WP_000004488.1.682 WP_000004488.1.68200 WP_000004488.1.68215 WP_000004488.1.68241 WP_000004488.1.68255 WP_000004488.1.68271 WP_000004488.1.68278 WP_000004488.1.68281 WP_000004488.1.68283 WP_000004488.1.68300 WP_000004488.1.68336 WP_000004488.1.68341 WP_000004488.1.68347 WP_000004488.1.68369 WP_000004488.1.68395 WP_000004488.1.68411 WP_000004488.1.68442 WP_000004488.1.68482 WP_000004488.1.68490 WP_000004488.1.68493 WP_000004488.1.68523 WP_000004488.1.68534 WP_000004488.1.68566 WP_000004488.1.68584 WP_000004488.1.68598 WP_000004488.1.6860 WP_000004488.1.68609 WP_000004488.1.68630 WP_000004488.1.68635 WP_000004488.1.68673 WP_000004488.1.68678 WP_000004488.1.68679 WP_000004488.1.68695 WP_000004488.1.68697 WP_000004488.1.68711 WP_000004488.1.68731 WP_000004488.1.68750 WP_000004488.1.68751 WP_000004488.1.68752 WP_000004488.1.6877 WP_000004488.1.68797 WP_000004488.1.6880 WP_000004488.1.68801 WP_000004488.1.68865 WP_000004488.1.6887 WP_000004488.1.68880 WP_000004488.1.68915 WP_000004488.1.68924 WP_000004488.1.68936 WP_000004488.1.68956 WP_000004488.1.68961 WP_000004488.1.6897 WP_000004488.1.68989 WP_000004488.1.69033 WP_000004488.1.69039 WP_000004488.1.69054 WP_000004488.1.69098 WP_000004488.1.69126 WP_000004488.1.69127 WP_000004488.1.69144 WP_000004488.1.6916 WP_000004488.1.69160 WP_000004488.1.6919 WP_000004488.1.69192 WP_000004488.1.6921 WP_000004488.1.69221 WP_000004488.1.6923 WP_000004488.1.69247 WP_000004488.1.69258 WP_000004488.1.69261 WP_000004488.1.6929 WP_000004488.1.69303 WP_000004488.1.69305 WP_000004488.1.69341 WP_000004488.1.69350 WP_000004488.1.69351 WP_000004488.1.69390 WP_000004488.1.694 WP_000004488.1.69404 WP_000004488.1.69441 WP_000004488.1.6945 WP_000004488.1.69472 WP_000004488.1.69473 WP_000004488.1.69537 WP_000004488.1.69551 WP_000004488.1.69583 WP_000004488.1.69589 WP_000004488.1.69593 WP_000004488.1.69596 WP_000004488.1.69605 WP_000004488.1.69646 WP_000004488.1.69689 WP_000004488.1.69730 WP_000004488.1.69780 WP_000004488.1.69786 WP_000004488.1.69803 WP_000004488.1.69810 WP_000004488.1.69818 WP_000004488.1.69868 WP_000004488.1.69887 WP_000004488.1.69896 WP_000004488.1.6993 WP_000004488.1.69972 WP_000004488.1.69979 WP_000004488.1.70041 WP_000004488.1.70063 WP_000004488.1.70081 WP_000004488.1.70123 WP_000004488.1.70125 WP_000004488.1.7013 WP_000004488.1.70149 WP_000004488.1.70190 WP_000004488.1.70191 WP_000004488.1.70213 WP_000004488.1.70251 WP_000004488.1.70256 WP_000004488.1.70341 WP_000004488.1.70357 WP_000004488.1.70407 WP_000004488.1.70414 WP_000004488.1.70477 WP_000004488.1.70509 WP_000004488.1.70517 WP_000004488.1.7052 WP_000004488.1.70530 WP_000004488.1.70539 WP_000004488.1.70576 WP_000004488.1.70578 WP_000004488.1.70582 WP_000004488.1.70592 WP_000004488.1.70597 WP_000004488.1.70600 WP_000004488.1.70619 WP_000004488.1.70628 WP_000004488.1.70656 WP_000004488.1.70694 WP_000004488.1.70698 WP_000004488.1.70713 WP_000004488.1.70723 WP_000004488.1.70728 WP_000004488.1.70745 WP_000004488.1.70747 WP_000004488.1.70748 WP_000004488.1.70767 WP_000004488.1.70787 WP_000004488.1.70794 WP_000004488.1.70801 WP_000004488.1.70803 WP_000004488.1.70880 WP_000004488.1.70896 WP_000004488.1.7090 WP_000004488.1.70900 WP_000004488.1.70952 WP_000004488.1.70967 WP_000004488.1.71003 WP_000004488.1.71037 WP_000004488.1.71042 WP_000004488.1.71062 WP_000004488.1.71099 WP_000004488.1.71109 WP_000004488.1.71113 WP_000004488.1.71134 WP_000004488.1.71144 WP_000004488.1.71147 WP_000004488.1.71149 WP_000004488.1.71158 WP_000004488.1.71159 WP_000004488.1.71162 WP_000004488.1.71170 WP_000004488.1.71176 WP_000004488.1.71183 WP_000004488.1.71199 WP_000004488.1.71205 WP_000004488.1.71221 WP_000004488.1.71223 WP_000004488.1.71225 WP_000004488.1.71226 WP_000004488.1.71229 WP_000004488.1.71264 WP_000004488.1.71269 WP_000004488.1.71273 WP_000004488.1.71275 WP_000004488.1.71285 WP_000004488.1.71312 WP_000004488.1.71315 WP_000004488.1.71327 WP_000004488.1.71339 WP_000004488.1.71354 WP_000004488.1.71397 WP_000004488.1.71409 WP_000004488.1.71421 WP_000004488.1.71423 WP_000004488.1.71448 WP_000004488.1.7147 WP_000004488.1.71480 WP_000004488.1.71522 WP_000004488.1.71537 WP_000004488.1.71540 WP_000004488.1.71560 WP_000004488.1.71632 WP_000004488.1.71680 WP_000004488.1.71690 WP_000004488.1.71724 WP_000004488.1.71757 WP_000004488.1.71767 WP_000004488.1.71783 WP_000004488.1.71832 WP_000004488.1.71837 WP_000004488.1.71840 WP_000004488.1.71856 WP_000004488.1.71874 WP_000004488.1.7192 WP_000004488.1.71922 WP_000004488.1.71938 WP_000004488.1.71939 WP_000004488.1.71940 WP_000004488.1.71944 WP_000004488.1.71945 WP_000004488.1.71975 WP_000004488.1.71987 WP_000004488.1.71993 WP_000004488.1.71995 WP_000004488.1.72013 WP_000004488.1.72016 WP_000004488.1.72021 WP_000004488.1.72033 WP_000004488.1.72053 WP_000004488.1.72054 WP_000004488.1.72090 WP_000004488.1.7210 WP_000004488.1.72120 WP_000004488.1.72125 WP_000004488.1.72126 WP_000004488.1.72141 WP_000004488.1.72153 WP_000004488.1.72155 WP_000004488.1.72157 WP_000004488.1.72161 WP_000004488.1.72162 WP_000004488.1.72180 WP_000004488.1.72184 WP_000004488.1.72186 WP_000004488.1.72208 WP_000004488.1.72237 WP_000004488.1.72248 WP_000004488.1.72261 WP_000004488.1.72262 WP_000004488.1.72270 WP_000004488.1.72293 WP_000004488.1.72316 WP_000004488.1.72322 WP_000004488.1.72337 WP_000004488.1.72342 WP_000004488.1.72352 WP_000004488.1.72362 WP_000004488.1.72391 WP_000004488.1.72392 WP_000004488.1.72397 WP_000004488.1.72414 WP_000004488.1.72427 WP_000004488.1.72431 WP_000004488.1.72449 WP_000004488.1.72485 WP_000004488.1.72493 WP_000004488.1.72511 WP_000004488.1.72521 WP_000004488.1.72522 WP_000004488.1.72535 WP_000004488.1.72537 WP_000004488.1.72544 WP_000004488.1.72574 WP_000004488.1.72593 WP_000004488.1.72606 WP_000004488.1.72608 WP_000004488.1.72614 WP_000004488.1.72615 WP_000004488.1.72616 WP_000004488.1.72619 WP_000004488.1.72641 WP_000004488.1.72643 WP_000004488.1.72651 WP_000004488.1.72652 WP_000004488.1.72663 WP_000004488.1.72694 WP_000004488.1.72695 WP_000004488.1.72698 WP_000004488.1.72725 WP_000004488.1.72729 WP_000004488.1.72738 WP_000004488.1.72745 WP_000004488.1.72747 WP_000004488.1.72748 WP_000004488.1.72751 WP_000004488.1.72758 WP_000004488.1.72764 WP_000004488.1.7277 WP_000004488.1.72778 WP_000004488.1.72804 WP_000004488.1.72806 WP_000004488.1.72837 WP_000004488.1.72860 WP_000004488.1.72869 WP_000004488.1.72893 WP_000004488.1.7291 WP_000004488.1.72910 WP_000004488.1.72913 WP_000004488.1.72947 WP_000004488.1.72956 WP_000004488.1.72998 WP_000004488.1.73000 WP_000004488.1.73010 WP_000004488.1.73015 WP_000004488.1.73032 WP_000004488.1.73039 WP_000004488.1.73061 WP_000004488.1.7307 WP_000004488.1.73072 WP_000004488.1.73075 WP_000004488.1.73085 WP_000004488.1.73094 WP_000004488.1.73126 WP_000004488.1.73129 WP_000004488.1.73193 WP_000004488.1.73197 WP_000004488.1.73217 WP_000004488.1.73239 WP_000004488.1.73249 WP_000004488.1.73251 WP_000004488.1.73257 WP_000004488.1.73259 WP_000004488.1.73277 WP_000004488.1.73278 WP_000004488.1.73283 WP_000004488.1.73292 WP_000004488.1.73295 WP_000004488.1.73326 WP_000004488.1.73343 WP_000004488.1.73349 WP_000004488.1.73385 WP_000004488.1.73393 WP_000004488.1.73428 WP_000004488.1.73430 WP_000004488.1.73468 WP_000004488.1.7349 WP_000004488.1.73498 WP_000004488.1.73524 WP_000004488.1.73565 WP_000004488.1.73592 WP_000004488.1.73604 WP_000004488.1.73626 WP_000004488.1.73631 WP_000004488.1.73652 WP_000004488.1.73663 WP_000004488.1.73700 WP_000004488.1.73709 WP_000004488.1.73717 WP_000004488.1.73743 WP_000004488.1.7376 WP_000004488.1.73785 WP_000004488.1.73797 WP_000004488.1.73801 WP_000004488.1.73807 WP_000004488.1.73811 WP_000004488.1.73827 WP_000004488.1.73835 WP_000004488.1.73843 WP_000004488.1.73844 WP_000004488.1.73846 WP_000004488.1.73859 WP_000004488.1.73882 WP_000004488.1.73897 WP_000004488.1.73908 WP_000004488.1.7392 WP_000004488.1.73934 WP_000004488.1.73942 WP_000004488.1.73968 WP_000004488.1.73980 WP_000004488.1.73995 WP_000004488.1.73996 WP_000004488.1.74045 WP_000004488.1.74046 WP_000004488.1.74051 WP_000004488.1.74053 WP_000004488.1.7411 WP_000004488.1.74123 WP_000004488.1.7413 WP_000004488.1.74156 WP_000004488.1.74184 WP_000004488.1.74213 WP_000004488.1.74223 WP_000004488.1.7424 WP_000004488.1.74243 WP_000004488.1.7425 WP_000004488.1.74251 WP_000004488.1.7429 WP_000004488.1.74294 WP_000004488.1.74309 WP_000004488.1.74365 WP_000004488.1.74367 WP_000004488.1.74423 WP_000004488.1.74431 WP_000004488.1.74444 WP_000004488.1.74445 WP_000004488.1.7446 WP_000004488.1.74465 WP_000004488.1.74478 WP_000004488.1.74491 WP_000004488.1.74501 WP_000004488.1.74509 WP_000004488.1.74513 WP_000004488.1.74520 WP_000004488.1.74521 WP_000004488.1.74528 WP_000004488.1.74532 WP_000004488.1.74536 WP_000004488.1.74549 WP_000004488.1.74557 WP_000004488.1.7461 WP_000004488.1.74624 WP_000004488.1.74625 WP_000004488.1.74631 WP_000004488.1.74652 WP_000004488.1.74670 WP_000004488.1.74687 WP_000004488.1.74688 WP_000004488.1.74689 WP_000004488.1.74691 WP_000004488.1.74705 WP_000004488.1.7471 WP_000004488.1.74713 WP_000004488.1.74716 WP_000004488.1.74735 WP_000004488.1.7475 WP_000004488.1.74752 WP_000004488.1.7478 WP_000004488.1.7479 WP_000004488.1.74793 WP_000004488.1.74811 WP_000004488.1.74828 WP_000004488.1.74844 WP_000004488.1.74852 WP_000004488.1.74867 WP_000004488.1.74873 WP_000004488.1.74879 WP_000004488.1.74880 WP_000004488.1.74885 WP_000004488.1.74889 WP_000004488.1.74895 WP_000004488.1.74904 WP_000004488.1.74914 WP_000004488.1.74962 WP_000004488.1.74975 WP_000004488.1.74993 WP_000004488.1.74998 WP_000004488.1.75003 WP_000004488.1.75021 WP_000004488.1.75029 WP_000004488.1.75030 WP_000004488.1.75112 WP_000004488.1.75124 WP_000004488.1.75136 WP_000004488.1.75138 WP_000004488.1.75139 WP_000004488.1.75143 WP_000004488.1.75145 WP_000004488.1.75149 WP_000004488.1.75155 WP_000004488.1.7516 WP_000004488.1.75164 WP_000004488.1.75181 WP_000004488.1.75209 WP_000004488.1.75218 WP_000004488.1.75219 WP_000004488.1.75221 WP_000004488.1.75243 WP_000004488.1.75247 WP_000004488.1.75248 WP_000004488.1.75254 WP_000004488.1.75270 WP_000004488.1.75272 WP_000004488.1.75306 WP_000004488.1.7536 WP_000004488.1.75360 WP_000004488.1.75367 WP_000004488.1.75382 WP_000004488.1.7539 WP_000004488.1.75428 WP_000004488.1.75435 WP_000004488.1.75465 WP_000004488.1.75491 WP_000004488.1.75505 WP_000004488.1.75507 WP_000004488.1.75529 WP_000004488.1.75536 WP_000004488.1.75537 WP_000004488.1.75568 WP_000004488.1.75577 WP_000004488.1.75588 WP_000004488.1.75594 WP_000004488.1.75602 WP_000004488.1.75612 WP_000004488.1.75629 WP_000004488.1.75644 WP_000004488.1.75653 WP_000004488.1.75672 WP_000004488.1.75676 WP_000004488.1.75679 WP_000004488.1.75687 WP_000004488.1.75694 WP_000004488.1.75696 WP_000004488.1.75698 WP_000004488.1.75699 WP_000004488.1.75725 WP_000004488.1.75735 WP_000004488.1.75758 WP_000004488.1.75767 WP_000004488.1.75786 WP_000004488.1.75803 WP_000004488.1.7583 WP_000004488.1.75839 WP_000004488.1.75853 WP_000004488.1.75918 WP_000004488.1.75973 WP_000004488.1.75983 WP_000004488.1.75989 WP_000004488.1.75995 WP_000004488.1.76009 WP_000004488.1.7603 WP_000004488.1.76036 WP_000004488.1.76039 WP_000004488.1.76054 WP_000004488.1.7608 WP_000004488.1.76087 WP_000004488.1.76089 WP_000004488.1.76103 WP_000004488.1.76118 WP_000004488.1.76119 WP_000004488.1.76129 WP_000004488.1.76152 WP_000004488.1.7617 WP_000004488.1.76184 WP_000004488.1.76189 WP_000004488.1.76196 WP_000004488.1.76305 WP_000004488.1.76312 WP_000004488.1.76361 WP_000004488.1.7637 WP_000004488.1.76384 WP_000004488.1.76387 WP_000004488.1.76390 WP_000004488.1.76407 WP_000004488.1.76446 WP_000004488.1.76447 WP_000004488.1.76448 WP_000004488.1.76452 WP_000004488.1.76460 WP_000004488.1.76462 WP_000004488.1.76466 WP_000004488.1.76477 WP_000004488.1.76542 WP_000004488.1.76544 WP_000004488.1.76547 WP_000004488.1.76562 WP_000004488.1.76595 WP_000004488.1.7661 WP_000004488.1.76612 WP_000004488.1.76619 WP_000004488.1.76656 WP_000004488.1.76697 WP_000004488.1.76701 WP_000004488.1.76705 WP_000004488.1.76707 WP_000004488.1.76712 WP_000004488.1.76751 WP_000004488.1.7680 WP_000004488.1.76815 WP_000004488.1.76827 WP_000004488.1.76831 WP_000004488.1.76840 WP_000004488.1.76884 WP_000004488.1.76909 WP_000004488.1.76918 WP_000004488.1.76948 WP_000004488.1.76957 WP_000004488.1.76965 WP_000004488.1.76966 WP_000004488.1.7699 WP_000004488.1.77015 WP_000004488.1.77022 WP_000004488.1.77042 WP_000004488.1.77070 WP_000004488.1.77099 WP_000004488.1.77109 WP_000004488.1.77120 WP_000004488.1.77128 WP_000004488.1.77134 WP_000004488.1.77147 WP_000004488.1.77162 WP_000004488.1.77163 WP_000004488.1.77173 WP_000004488.1.77175 WP_000004488.1.77198 WP_000004488.1.77214 WP_000004488.1.77239 WP_000004488.1.77255 WP_000004488.1.77258 WP_000004488.1.77275 WP_000004488.1.7728 WP_000004488.1.77284 WP_000004488.1.77288 WP_000004488.1.77290 WP_000004488.1.77291 WP_000004488.1.77296 WP_000004488.1.7731 WP_000004488.1.77341 WP_000004488.1.77358 WP_000004488.1.77391 WP_000004488.1.77392 WP_000004488.1.77437 WP_000004488.1.77448 WP_000004488.1.77462 WP_000004488.1.77470 WP_000004488.1.77471 WP_000004488.1.77477 WP_000004488.1.77495 WP_000004488.1.775 WP_000004488.1.77503 WP_000004488.1.77542 WP_000004488.1.77551 WP_000004488.1.77577 WP_000004488.1.77581 WP_000004488.1.77595 WP_000004488.1.77600 WP_000004488.1.77608 WP_000004488.1.77626 WP_000004488.1.77632 WP_000004488.1.77644 WP_000004488.1.77648 WP_000004488.1.77707 WP_000004488.1.77725 WP_000004488.1.77741 WP_000004488.1.77760 WP_000004488.1.77767 WP_000004488.1.77768 WP_000004488.1.7781 WP_000004488.1.77826 WP_000004488.1.77833 WP_000004488.1.77876 WP_000004488.1.77929 WP_000004488.1.77949 WP_000004488.1.7795 WP_000004488.1.77961 WP_000004488.1.77979 WP_000004488.1.7799 WP_000004488.1.77999 WP_000004488.1.78000 WP_000004488.1.78007 WP_000004488.1.7804 WP_000004488.1.78041 WP_000004488.1.78059 WP_000004488.1.7806 WP_000004488.1.78063 WP_000004488.1.7808 WP_000004488.1.78089 WP_000004488.1.78097 WP_000004488.1.78099 WP_000004488.1.78102 WP_000004488.1.78131 WP_000004488.1.78188 WP_000004488.1.78196 WP_000004488.1.78202 WP_000004488.1.78233 WP_000004488.1.78321 WP_000004488.1.78323 WP_000004488.1.78337 WP_000004488.1.78340 WP_000004488.1.78377 WP_000004488.1.78390 WP_000004488.1.784 WP_000004488.1.78413 WP_000004488.1.78445 WP_000004488.1.78453 WP_000004488.1.78462 WP_000004488.1.7847 WP_000004488.1.78477 WP_000004488.1.78481 WP_000004488.1.7851 WP_000004488.1.78515 WP_000004488.1.78527 WP_000004488.1.7855 WP_000004488.1.78553 WP_000004488.1.78583 WP_000004488.1.78586 WP_000004488.1.78593 WP_000004488.1.78610 WP_000004488.1.78611 WP_000004488.1.78612 WP_000004488.1.78615 WP_000004488.1.78683 WP_000004488.1.78696 WP_000004488.1.78698 WP_000004488.1.78706 WP_000004488.1.78718 WP_000004488.1.78746 WP_000004488.1.78750 WP_000004488.1.78757 WP_000004488.1.78775 WP_000004488.1.78791 WP_000004488.1.7883 WP_000004488.1.78843 WP_000004488.1.78854 WP_000004488.1.78891 WP_000004488.1.78908 WP_000004488.1.78919 WP_000004488.1.78953 WP_000004488.1.7896 WP_000004488.1.7898 WP_000004488.1.78996 WP_000004488.1.79002 WP_000004488.1.79004 WP_000004488.1.7901 WP_000004488.1.79065 WP_000004488.1.79067 WP_000004488.1.79075 WP_000004488.1.79086 WP_000004488.1.79088 WP_000004488.1.79090 WP_000004488.1.79092 WP_000004488.1.79126 WP_000004488.1.79137 WP_000004488.1.79159 WP_000004488.1.79172 WP_000004488.1.79226 WP_000004488.1.79233 WP_000004488.1.79246 WP_000004488.1.79248 WP_000004488.1.79249 WP_000004488.1.79306 WP_000004488.1.79308 WP_000004488.1.79312 WP_000004488.1.79343 WP_000004488.1.79346 WP_000004488.1.79356 WP_000004488.1.79369 WP_000004488.1.79389 WP_000004488.1.79391 WP_000004488.1.7940 WP_000004488.1.79414 WP_000004488.1.79416 WP_000004488.1.79443 WP_000004488.1.79464 WP_000004488.1.79478 WP_000004488.1.79505 WP_000004488.1.79519 WP_000004488.1.7952 WP_000004488.1.79525 WP_000004488.1.79526 WP_000004488.1.79528 WP_000004488.1.79540 WP_000004488.1.79558 WP_000004488.1.79563 WP_000004488.1.79576 WP_000004488.1.79591 WP_000004488.1.79606 WP_000004488.1.79640 WP_000004488.1.79685 WP_000004488.1.79713 WP_000004488.1.79715 WP_000004488.1.79759 WP_000004488.1.79764 WP_000004488.1.79800 WP_000004488.1.79816 WP_000004488.1.79824 WP_000004488.1.79840 WP_000004488.1.7985 WP_000004488.1.79869 WP_000004488.1.7987 WP_000004488.1.79871 WP_000004488.1.79877 WP_000004488.1.79905 WP_000004488.1.79922 WP_000004488.1.79930 WP_000004488.1.79931 WP_000004488.1.79932 WP_000004488.1.79936 WP_000004488.1.79944 WP_000004488.1.79952 WP_000004488.1.79965 WP_000004488.1.79984 WP_000004488.1.79995 WP_000004488.1.80011 WP_000004488.1.8004 WP_000004488.1.80043 WP_000004488.1.80050 WP_000004488.1.80060 WP_000004488.1.80061 WP_000004488.1.8007 WP_000004488.1.80071 WP_000004488.1.8011 WP_000004488.1.80112 WP_000004488.1.80136 WP_000004488.1.80141 WP_000004488.1.80176 WP_000004488.1.80179 WP_000004488.1.80183 WP_000004488.1.80192 WP_000004488.1.80255 WP_000004488.1.80292 WP_000004488.1.80309 WP_000004488.1.80310 WP_000004488.1.80320 WP_000004488.1.80330 WP_000004488.1.80388 WP_000004488.1.80426 WP_000004488.1.80428 WP_000004488.1.80440 WP_000004488.1.80456 WP_000004488.1.80463 WP_000004488.1.80484 WP_000004488.1.80517 WP_000004488.1.80524 WP_000004488.1.80545 WP_000004488.1.8057 WP_000004488.1.80577 WP_000004488.1.80578 WP_000004488.1.80594 WP_000004488.1.80606 WP_000004488.1.80612 WP_000004488.1.80662 WP_000004488.1.80666 WP_000004488.1.80676 WP_000004488.1.8068 WP_000004488.1.80709 WP_000004488.1.80718 WP_000004488.1.80731 WP_000004488.1.80736 WP_000004488.1.80737 WP_000004488.1.8074 WP_000004488.1.80753 WP_000004488.1.80754 WP_000004488.1.80756 WP_000004488.1.80768 WP_000004488.1.80789 WP_000004488.1.808 WP_000004488.1.80804 WP_000004488.1.80805 WP_000004488.1.80843 WP_000004488.1.80862 WP_000004488.1.80882 WP_000004488.1.80884 WP_000004488.1.80894 WP_000004488.1.8090 WP_000004488.1.8091 WP_000004488.1.80935 WP_000004488.1.80945 WP_000004488.1.80946 WP_000004488.1.80954 WP_000004488.1.80966 WP_000004488.1.80983 WP_000004488.1.80985 WP_000004488.1.810 WP_000004488.1.81026 WP_000004488.1.81034 WP_000004488.1.81054 WP_000004488.1.81070 WP_000004488.1.81071 WP_000004488.1.811 WP_000004488.1.81104 WP_000004488.1.81127 WP_000004488.1.81160 WP_000004488.1.81165 WP_000004488.1.8118 WP_000004488.1.81180 WP_000004488.1.81182 WP_000004488.1.8121 WP_000004488.1.81267 WP_000004488.1.81273 WP_000004488.1.81281 WP_000004488.1.81283 WP_000004488.1.81286 WP_000004488.1.81298 WP_000004488.1.81313 WP_000004488.1.81316 WP_000004488.1.81376 WP_000004488.1.81391 WP_000004488.1.81420 WP_000004488.1.81423 WP_000004488.1.81438 WP_000004488.1.81442 WP_000004488.1.81469 WP_000004488.1.81475 WP_000004488.1.81484 WP_000004488.1.81514 WP_000004488.1.81517 WP_000004488.1.8156 WP_000004488.1.81576 WP_000004488.1.81577 WP_000004488.1.81580 WP_000004488.1.81582 WP_000004488.1.81596 WP_000004488.1.81602 WP_000004488.1.81618 WP_000004488.1.81625 WP_000004488.1.81688 WP_000004488.1.81692 WP_000004488.1.81715 WP_000004488.1.81723 WP_000004488.1.81754 WP_000004488.1.81806 WP_000004488.1.81819 WP_000004488.1.81821 WP_000004488.1.8183 WP_000004488.1.81832 WP_000004488.1.81843 WP_000004488.1.81869 WP_000004488.1.81873 WP_000004488.1.81876 WP_000004488.1.81881 WP_000004488.1.81888 WP_000004488.1.81914 WP_000004488.1.81934 WP_000004488.1.81935 WP_000004488.1.81939 WP_000004488.1.81952 WP_000004488.1.81956 WP_000004488.1.81972 WP_000004488.1.81975 WP_000004488.1.82 WP_000004488.1.82010 WP_000004488.1.82032 WP_000004488.1.82057 WP_000004488.1.82059 WP_000004488.1.82061 WP_000004488.1.82062 WP_000004488.1.82074 WP_000004488.1.82095 WP_000004488.1.82116 WP_000004488.1.82137 WP_000004488.1.82217 WP_000004488.1.82239 WP_000004488.1.82240 WP_000004488.1.82242 WP_000004488.1.82246 WP_000004488.1.82275 WP_000004488.1.82280 WP_000004488.1.82296 WP_000004488.1.82316 WP_000004488.1.82320 WP_000004488.1.82326 WP_000004488.1.82330 WP_000004488.1.8235 WP_000004488.1.82378 WP_000004488.1.82438 WP_000004488.1.82439 WP_000004488.1.82485 WP_000004488.1.82499 WP_000004488.1.82507 WP_000004488.1.82514 WP_000004488.1.82536 WP_000004488.1.82572 WP_000004488.1.82594 WP_000004488.1.82614 WP_000004488.1.82626 WP_000004488.1.82629 WP_000004488.1.82647 WP_000004488.1.8268 WP_000004488.1.82691 WP_000004488.1.82698 WP_000004488.1.82700 WP_000004488.1.82705 WP_000004488.1.82711 WP_000004488.1.82715 WP_000004488.1.82754 WP_000004488.1.8277 WP_000004488.1.82776 WP_000004488.1.82780 WP_000004488.1.82784 WP_000004488.1.82797 WP_000004488.1.82799 WP_000004488.1.82808 WP_000004488.1.82820 WP_000004488.1.82831 WP_000004488.1.82833 WP_000004488.1.82902 WP_000004488.1.82923 WP_000004488.1.82991 WP_000004488.1.83020 WP_000004488.1.83033 WP_000004488.1.83035 WP_000004488.1.83051 WP_000004488.1.8306 WP_000004488.1.8308 WP_000004488.1.83093 WP_000004488.1.83097 WP_000004488.1.83099 WP_000004488.1.831 WP_000004488.1.83140 WP_000004488.1.83144 WP_000004488.1.83151 WP_000004488.1.83160 WP_000004488.1.83177 WP_000004488.1.83205 WP_000004488.1.83214 WP_000004488.1.83224 WP_000004488.1.83286 WP_000004488.1.83321 WP_000004488.1.83330 WP_000004488.1.83340 WP_000004488.1.83347 WP_000004488.1.83415 WP_000004488.1.8345 WP_000004488.1.83466 WP_000004488.1.83481 WP_000004488.1.83537 WP_000004488.1.83544 WP_000004488.1.83564 WP_000004488.1.83584 WP_000004488.1.83660 WP_000004488.1.8368 WP_000004488.1.83684 WP_000004488.1.83712 WP_000004488.1.83735 WP_000004488.1.83762 WP_000004488.1.83781 WP_000004488.1.83820 WP_000004488.1.8384 WP_000004488.1.83879 WP_000004488.1.83941 WP_000004488.1.83947 WP_000004488.1.84060 WP_000004488.1.84074 WP_000004488.1.8411 WP_000004488.1.84140 WP_000004488.1.84164 WP_000004488.1.84172 WP_000004488.1.84210 WP_000004488.1.84219 WP_000004488.1.84221 WP_000004488.1.84264 WP_000004488.1.84298 WP_000004488.1.84312 WP_000004488.1.84319 WP_000004488.1.84331 WP_000004488.1.84339 WP_000004488.1.84348 WP_000004488.1.84402 WP_000004488.1.84405 WP_000004488.1.84436 WP_000004488.1.8444 WP_000004488.1.84462 WP_000004488.1.84473 WP_000004488.1.84482 WP_000004488.1.84484 WP_000004488.1.84511 WP_000004488.1.84518 WP_000004488.1.84534 WP_000004488.1.84584 WP_000004488.1.84635 WP_000004488.1.84656 WP_000004488.1.84657 WP_000004488.1.84668 WP_000004488.1.84675 WP_000004488.1.84697 WP_000004488.1.8470 WP_000004488.1.84731 WP_000004488.1.84738 WP_000004488.1.84740 WP_000004488.1.84768 WP_000004488.1.8477 WP_000004488.1.84841 WP_000004488.1.84850 WP_000004488.1.84875 WP_000004488.1.84877 WP_000004488.1.84878 WP_000004488.1.84881 WP_000004488.1.84893 WP_000004488.1.84894 WP_000004488.1.84916 WP_000004488.1.84929 WP_000004488.1.84941 WP_000004488.1.84972 WP_000004488.1.84977 WP_000004488.1.84986 WP_000004488.1.84989 WP_000004488.1.84990 WP_000004488.1.84994 WP_000004488.1.85002 WP_000004488.1.85008 WP_000004488.1.85011 WP_000004488.1.85052 WP_000004488.1.85077 WP_000004488.1.85098 WP_000004488.1.85105 WP_000004488.1.85106 WP_000004488.1.85112 WP_000004488.1.85141 WP_000004488.1.85155 WP_000004488.1.85156 WP_000004488.1.8517 WP_000004488.1.85175 WP_000004488.1.85188 WP_000004488.1.85216 WP_000004488.1.85241 WP_000004488.1.85247 WP_000004488.1.85253 WP_000004488.1.85255 WP_000004488.1.85260 WP_000004488.1.85305 WP_000004488.1.85310 WP_000004488.1.85320 WP_000004488.1.85323 WP_000004488.1.85335 WP_000004488.1.85336 WP_000004488.1.85342 WP_000004488.1.85361 WP_000004488.1.85369 WP_000004488.1.85384 WP_000004488.1.85385 WP_000004488.1.85416 WP_000004488.1.85435 WP_000004488.1.85500 WP_000004488.1.85525 WP_000004488.1.85546 WP_000004488.1.85558 WP_000004488.1.85563 WP_000004488.1.8560 WP_000004488.1.85601 WP_000004488.1.85621 WP_000004488.1.8564 WP_000004488.1.85657 WP_000004488.1.85685 WP_000004488.1.85722 WP_000004488.1.85752 WP_000004488.1.85762 WP_000004488.1.85767 WP_000004488.1.85772 WP_000004488.1.8579 WP_000004488.1.85793 WP_000004488.1.85800 WP_000004488.1.85806 WP_000004488.1.85857 WP_000004488.1.85895 WP_000004488.1.8592 WP_000004488.1.85939 WP_000004488.1.85944 WP_000004488.1.85948 WP_000004488.1.85969 WP_000004488.1.86 WP_000004488.1.86001 WP_000004488.1.86016 WP_000004488.1.86035 WP_000004488.1.86063 WP_000004488.1.8607 WP_000004488.1.86105 WP_000004488.1.86115 WP_000004488.1.86145 WP_000004488.1.86149 WP_000004488.1.86161 WP_000004488.1.86171 WP_000004488.1.86176 WP_000004488.1.86181 WP_000004488.1.86189 WP_000004488.1.8621 WP_000004488.1.86210 WP_000004488.1.86225 WP_000004488.1.86227 WP_000004488.1.86234 WP_000004488.1.86255 WP_000004488.1.86263 WP_000004488.1.86266 WP_000004488.1.86276 WP_000004488.1.86280 WP_000004488.1.86283 WP_000004488.1.86294 WP_000004488.1.86307 WP_000004488.1.86340 WP_000004488.1.8635 WP_000004488.1.86355 WP_000004488.1.86371 WP_000004488.1.86393 WP_000004488.1.86411 WP_000004488.1.86412 WP_000004488.1.86437 WP_000004488.1.86451 WP_000004488.1.86452 WP_000004488.1.86454 WP_000004488.1.86461 WP_000004488.1.86475 WP_000004488.1.86483 WP_000004488.1.86492 WP_000004488.1.86518 WP_000004488.1.8652 WP_000004488.1.86574 WP_000004488.1.86583 WP_000004488.1.86598 WP_000004488.1.86609 WP_000004488.1.86617 WP_000004488.1.86640 WP_000004488.1.86667 WP_000004488.1.86674 WP_000004488.1.86681 WP_000004488.1.86691 WP_000004488.1.86707 WP_000004488.1.86731 WP_000004488.1.86734 WP_000004488.1.86760 WP_000004488.1.86768 WP_000004488.1.86787 WP_000004488.1.86788 WP_000004488.1.8679 WP_000004488.1.86833 WP_000004488.1.86846 WP_000004488.1.86848 WP_000004488.1.8687 WP_000004488.1.86935 WP_000004488.1.86956 WP_000004488.1.86959 WP_000004488.1.86975 WP_000004488.1.86994 WP_000004488.1.86997 WP_000004488.1.87059 WP_000004488.1.87075 WP_000004488.1.87076 WP_000004488.1.87109 WP_000004488.1.87147 WP_000004488.1.87177 WP_000004488.1.87189 WP_000004488.1.87199 WP_000004488.1.87247 WP_000004488.1.87249 WP_000004488.1.87254 WP_000004488.1.87310 WP_000004488.1.87339 WP_000004488.1.87358 WP_000004488.1.87382 WP_000004488.1.87389 WP_000004488.1.87400 WP_000004488.1.87410 WP_000004488.1.87465 WP_000004488.1.87557 WP_000004488.1.87563 WP_000004488.1.87568 WP_000004488.1.87574 WP_000004488.1.87608 WP_000004488.1.87610 WP_000004488.1.87616 WP_000004488.1.87635 WP_000004488.1.87639 WP_000004488.1.87655 WP_000004488.1.87694 WP_000004488.1.8771 WP_000004488.1.87721 WP_000004488.1.87726 WP_000004488.1.87728 WP_000004488.1.87786 WP_000004488.1.87788 WP_000004488.1.87789 WP_000004488.1.87822 WP_000004488.1.87834 WP_000004488.1.87857 WP_000004488.1.87914 WP_000004488.1.87919 WP_000004488.1.87976 WP_000004488.1.87980 WP_000004488.1.87984 WP_000004488.1.880 WP_000004488.1.88017 WP_000004488.1.88020 WP_000004488.1.88066 WP_000004488.1.88088 WP_000004488.1.88110 WP_000004488.1.88149 WP_000004488.1.88155 WP_000004488.1.88189 WP_000004488.1.88197 WP_000004488.1.88238 WP_000004488.1.88252 WP_000004488.1.88285 WP_000004488.1.88301 WP_000004488.1.88304 WP_000004488.1.88352 WP_000004488.1.88376 WP_000004488.1.88379 WP_000004488.1.88384 WP_000004488.1.88413 WP_000004488.1.88427 WP_000004488.1.8843 WP_000004488.1.88434 WP_000004488.1.88438 WP_000004488.1.88462 WP_000004488.1.8848 WP_000004488.1.88505 WP_000004488.1.88524 WP_000004488.1.88528 WP_000004488.1.88535 WP_000004488.1.88539 WP_000004488.1.8854 WP_000004488.1.88577 WP_000004488.1.88598 WP_000004488.1.88607 WP_000004488.1.88631 WP_000004488.1.88646 WP_000004488.1.88667 WP_000004488.1.88678 WP_000004488.1.88685 WP_000004488.1.88709 WP_000004488.1.88710 WP_000004488.1.88711 WP_000004488.1.88717 WP_000004488.1.88720 WP_000004488.1.88729 WP_000004488.1.8873 WP_000004488.1.88732 WP_000004488.1.88735 WP_000004488.1.88757 WP_000004488.1.88759 WP_000004488.1.8879 WP_000004488.1.88803 WP_000004488.1.88834 WP_000004488.1.88864 WP_000004488.1.88880 WP_000004488.1.88883 WP_000004488.1.88891 WP_000004488.1.88950 WP_000004488.1.88953 WP_000004488.1.88997 WP_000004488.1.89018 WP_000004488.1.89050 WP_000004488.1.8906 WP_000004488.1.89067 WP_000004488.1.89090 WP_000004488.1.89097 WP_000004488.1.89099 WP_000004488.1.89111 WP_000004488.1.89163 WP_000004488.1.89183 WP_000004488.1.89197 WP_000004488.1.89200 WP_000004488.1.89214 WP_000004488.1.89255 WP_000004488.1.89305 WP_000004488.1.89322 WP_000004488.1.89335 WP_000004488.1.8938 WP_000004488.1.89385 WP_000004488.1.894 WP_000004488.1.89400 WP_000004488.1.89403 WP_000004488.1.89405 WP_000004488.1.89416 WP_000004488.1.89432 WP_000004488.1.8945 WP_000004488.1.89458 WP_000004488.1.89466 WP_000004488.1.89468 WP_000004488.1.89471 WP_000004488.1.89474 WP_000004488.1.89479 WP_000004488.1.89492 WP_000004488.1.89510 WP_000004488.1.89551 WP_000004488.1.89569 WP_000004488.1.89583 WP_000004488.1.89601 WP_000004488.1.89605 WP_000004488.1.89630 WP_000004488.1.89646 WP_000004488.1.89656 WP_000004488.1.89674 WP_000004488.1.89679 WP_000004488.1.89710 WP_000004488.1.89768 WP_000004488.1.89781 WP_000004488.1.89788 WP_000004488.1.89818 WP_000004488.1.89839 WP_000004488.1.89841 WP_000004488.1.8985 WP_000004488.1.89852 WP_000004488.1.89859 WP_000004488.1.89895 WP_000004488.1.89899 WP_000004488.1.89915 WP_000004488.1.89918 WP_000004488.1.89920 WP_000004488.1.89923 WP_000004488.1.89925 WP_000004488.1.89927 WP_000004488.1.89959 WP_000004488.1.89977 WP_000004488.1.89988 WP_000004488.1.89998 WP_000004488.1.90017 WP_000004488.1.90022 WP_000004488.1.90063 WP_000004488.1.90065 WP_000004488.1.90078 WP_000004488.1.9010 WP_000004488.1.90115 WP_000004488.1.90128 WP_000004488.1.90139 WP_000004488.1.90146 WP_000004488.1.90156 WP_000004488.1.90168 WP_000004488.1.90182 WP_000004488.1.90219 WP_000004488.1.90249 WP_000004488.1.90256 WP_000004488.1.90257 WP_000004488.1.90266 WP_000004488.1.90270 WP_000004488.1.90314 WP_000004488.1.90332 WP_000004488.1.90342 WP_000004488.1.90349 WP_000004488.1.90358 WP_000004488.1.9036 WP_000004488.1.90389 WP_000004488.1.90405 WP_000004488.1.90435 WP_000004488.1.90436 WP_000004488.1.90441 WP_000004488.1.90449 WP_000004488.1.90467 WP_000004488.1.90511 WP_000004488.1.90520 WP_000004488.1.90525 WP_000004488.1.90536 WP_000004488.1.90547 WP_000004488.1.9059 WP_000004488.1.90591 WP_000004488.1.9061 WP_000004488.1.90626 WP_000004488.1.90706 WP_000004488.1.90758 WP_000004488.1.90799 WP_000004488.1.9081 WP_000004488.1.90813 WP_000004488.1.90822 WP_000004488.1.90828 WP_000004488.1.90834 WP_000004488.1.90837 WP_000004488.1.9084 WP_000004488.1.90848 WP_000004488.1.90856 WP_000004488.1.90864 WP_000004488.1.90865 WP_000004488.1.90873 WP_000004488.1.90890 WP_000004488.1.90951 WP_000004488.1.90967 WP_000004488.1.90979 WP_000004488.1.9098 WP_000004488.1.90997 WP_000004488.1.91 WP_000004488.1.91007 WP_000004488.1.91010 WP_000004488.1.91018 WP_000004488.1.9104 WP_000004488.1.91072 WP_000004488.1.91088 WP_000004488.1.91094 WP_000004488.1.91113 WP_000004488.1.91117 WP_000004488.1.91121 WP_000004488.1.91138 WP_000004488.1.91153 WP_000004488.1.91170 WP_000004488.1.9118 WP_000004488.1.91213 WP_000004488.1.91266 WP_000004488.1.91268 WP_000004488.1.91277 WP_000004488.1.91288 WP_000004488.1.91290 WP_000004488.1.91340 WP_000004488.1.91341 WP_000004488.1.91356 WP_000004488.1.91361 WP_000004488.1.91384 WP_000004488.1.91397 WP_000004488.1.91425 WP_000004488.1.91445 WP_000004488.1.91462 WP_000004488.1.91485 WP_000004488.1.915 WP_000004488.1.91511 WP_000004488.1.91516 WP_000004488.1.91526 WP_000004488.1.91543 WP_000004488.1.91548 WP_000004488.1.91549 WP_000004488.1.91551 WP_000004488.1.91565 WP_000004488.1.9157 WP_000004488.1.91594 WP_000004488.1.91596 WP_000004488.1.9160 WP_000004488.1.91626 WP_000004488.1.91630 WP_000004488.1.91640 WP_000004488.1.91643 WP_000004488.1.91644 WP_000004488.1.91651 WP_000004488.1.91672 WP_000004488.1.9168 WP_000004488.1.91685 WP_000004488.1.9169 WP_000004488.1.91701 WP_000004488.1.9171 WP_000004488.1.91739 WP_000004488.1.91779 WP_000004488.1.91782 WP_000004488.1.91787 WP_000004488.1.91793 WP_000004488.1.91801 WP_000004488.1.9185 WP_000004488.1.91850 WP_000004488.1.91871 WP_000004488.1.91951 WP_000004488.1.91959 WP_000004488.1.91965 WP_000004488.1.91971 WP_000004488.1.9199 WP_000004488.1.91994 WP_000004488.1.92014 WP_000004488.1.92029 WP_000004488.1.92031 WP_000004488.1.92048 WP_000004488.1.92058 WP_000004488.1.921 WP_000004488.1.92102 WP_000004488.1.92123 WP_000004488.1.9215 WP_000004488.1.92161 WP_000004488.1.92163 WP_000004488.1.92180 WP_000004488.1.92195 WP_000004488.1.92215 WP_000004488.1.92224 WP_000004488.1.92305 WP_000004488.1.92323 WP_000004488.1.92361 WP_000004488.1.924 WP_000004488.1.92434 WP_000004488.1.92462 WP_000004488.1.92473 WP_000004488.1.92495 WP_000004488.1.92496 WP_000004488.1.92506 WP_000004488.1.92532 WP_000004488.1.92535 WP_000004488.1.9255 WP_000004488.1.92568 WP_000004488.1.92571 WP_000004488.1.92577 WP_000004488.1.92614 WP_000004488.1.92615 WP_000004488.1.92634 WP_000004488.1.92638 WP_000004488.1.9264 WP_000004488.1.9266 WP_000004488.1.92668 WP_000004488.1.92693 WP_000004488.1.92708 WP_000004488.1.92719 WP_000004488.1.92742 WP_000004488.1.92750 WP_000004488.1.92780 WP_000004488.1.92781 WP_000004488.1.92792 WP_000004488.1.92793 WP_000004488.1.92796 WP_000004488.1.92819 WP_000004488.1.92845 WP_000004488.1.92865 WP_000004488.1.92882 WP_000004488.1.92886 WP_000004488.1.92932 WP_000004488.1.92943 WP_000004488.1.92953 WP_000004488.1.92989 WP_000004488.1.92991 WP_000004488.1.93005 WP_000004488.1.93016 WP_000004488.1.93019 WP_000004488.1.93027 WP_000004488.1.93033 WP_000004488.1.93048 WP_000004488.1.93052 WP_000004488.1.93054 WP_000004488.1.93069 WP_000004488.1.93072 WP_000004488.1.93085 WP_000004488.1.93100 WP_000004488.1.93133 WP_000004488.1.93167 WP_000004488.1.93175 WP_000004488.1.93185 WP_000004488.1.93252 WP_000004488.1.93267 WP_000004488.1.93276 WP_000004488.1.93309 WP_000004488.1.9331 WP_000004488.1.93312 WP_000004488.1.93338 WP_000004488.1.93379 WP_000004488.1.93388 WP_000004488.1.93427 WP_000004488.1.93428 WP_000004488.1.93463 WP_000004488.1.93468 WP_000004488.1.93509 WP_000004488.1.93531 WP_000004488.1.93552 WP_000004488.1.9356 WP_000004488.1.93569 WP_000004488.1.93601 WP_000004488.1.93605 WP_000004488.1.93621 WP_000004488.1.93630 WP_000004488.1.93634 WP_000004488.1.93637 WP_000004488.1.93652 WP_000004488.1.93665 WP_000004488.1.93670 WP_000004488.1.93673 WP_000004488.1.93695 WP_000004488.1.93716 WP_000004488.1.93733 WP_000004488.1.93737 WP_000004488.1.93742 WP_000004488.1.93743 WP_000004488.1.93745 WP_000004488.1.93755 WP_000004488.1.93768 WP_000004488.1.938 WP_000004488.1.93800 WP_000004488.1.93821 WP_000004488.1.93873 WP_000004488.1.93877 WP_000004488.1.939 WP_000004488.1.93900 WP_000004488.1.93911 WP_000004488.1.93918 WP_000004488.1.93921 WP_000004488.1.93951 WP_000004488.1.93971 WP_000004488.1.94025 WP_000004488.1.94035 WP_000004488.1.94057 WP_000004488.1.94156 WP_000004488.1.9416 WP_000004488.1.94176 WP_000004488.1.94187 WP_000004488.1.94190 WP_000004488.1.94213 WP_000004488.1.94232 WP_000004488.1.9426 WP_000004488.1.94271 WP_000004488.1.94298 WP_000004488.1.94302 WP_000004488.1.94317 WP_000004488.1.94343 WP_000004488.1.94353 WP_000004488.1.94388 WP_000004488.1.94404 WP_000004488.1.94429 WP_000004488.1.94430 WP_000004488.1.94445 WP_000004488.1.94468 WP_000004488.1.94475 WP_000004488.1.94497 WP_000004488.1.94507 WP_000004488.1.94516 WP_000004488.1.94523 WP_000004488.1.94542 WP_000004488.1.94544 WP_000004488.1.94548 WP_000004488.1.9457 WP_000004488.1.94580 WP_000004488.1.94589 WP_000004488.1.94626 WP_000004488.1.94676 WP_000004488.1.94690 WP_000004488.1.94692 WP_000004488.1.94695 WP_000004488.1.94738 WP_000004488.1.94739 WP_000004488.1.94753 WP_000004488.1.94764 WP_000004488.1.94787 WP_000004488.1.94790 WP_000004488.1.948 WP_000004488.1.94801 WP_000004488.1.94808 WP_000004488.1.94823 WP_000004488.1.94841 WP_000004488.1.94847 WP_000004488.1.94877 WP_000004488.1.94880 WP_000004488.1.94889 WP_000004488.1.9489 WP_000004488.1.94898 WP_000004488.1.949 WP_000004488.1.94903 WP_000004488.1.9491 WP_000004488.1.94927 WP_000004488.1.94934 WP_000004488.1.94938 WP_000004488.1.94949 WP_000004488.1.94963 WP_000004488.1.94991 WP_000004488.1.94993 WP_000004488.1.95005 WP_000004488.1.95011 WP_000004488.1.95022 WP_000004488.1.95028 WP_000004488.1.95035 WP_000004488.1.95036 WP_000004488.1.95037 WP_000004488.1.95062 WP_000004488.1.95080 WP_000004488.1.95129 WP_000004488.1.9513 WP_000004488.1.95161 WP_000004488.1.95198 WP_000004488.1.95233 WP_000004488.1.95243 WP_000004488.1.95244 WP_000004488.1.95254 WP_000004488.1.95332 WP_000004488.1.95368 WP_000004488.1.95381 WP_000004488.1.95390 WP_000004488.1.95395 WP_000004488.1.95400 WP_000004488.1.95403 WP_000004488.1.95424 WP_000004488.1.95431 WP_000004488.1.95438 WP_000004488.1.95521 WP_000004488.1.95563 WP_000004488.1.9559 WP_000004488.1.95595 WP_000004488.1.95596 WP_000004488.1.95604 WP_000004488.1.95655 WP_000004488.1.95680 WP_000004488.1.95712 WP_000004488.1.95756 WP_000004488.1.95759 WP_000004488.1.95800 WP_000004488.1.95801 WP_000004488.1.95821 WP_000004488.1.95824 WP_000004488.1.95827 WP_000004488.1.95834 WP_000004488.1.95835 WP_000004488.1.95846 WP_000004488.1.95865 WP_000004488.1.95869 WP_000004488.1.95916 WP_000004488.1.95919 WP_000004488.1.95931 WP_000004488.1.95932 WP_000004488.1.95951 WP_000004488.1.96032 WP_000004488.1.96053 WP_000004488.1.96059 WP_000004488.1.96066 WP_000004488.1.96086 WP_000004488.1.96110 WP_000004488.1.96114 WP_000004488.1.96128 WP_000004488.1.9616 WP_000004488.1.96177 WP_000004488.1.96215 WP_000004488.1.96222 WP_000004488.1.96229 WP_000004488.1.96247 WP_000004488.1.96279 WP_000004488.1.96281 WP_000004488.1.96290 WP_000004488.1.96293 WP_000004488.1.96299 WP_000004488.1.96303 WP_000004488.1.96339 WP_000004488.1.96341 WP_000004488.1.96378 WP_000004488.1.96394 WP_000004488.1.96417 WP_000004488.1.96420 WP_000004488.1.96425 WP_000004488.1.96450 WP_000004488.1.96457 WP_000004488.1.96479 WP_000004488.1.96480 WP_000004488.1.96484 WP_000004488.1.96494 WP_000004488.1.96519 WP_000004488.1.96541 WP_000004488.1.96562 WP_000004488.1.9657 WP_000004488.1.96585 WP_000004488.1.96608 WP_000004488.1.9661 WP_000004488.1.96617 WP_000004488.1.96659 WP_000004488.1.96680 WP_000004488.1.96683 WP_000004488.1.96701 WP_000004488.1.96725 WP_000004488.1.96743 WP_000004488.1.96753 WP_000004488.1.96769 WP_000004488.1.96779 WP_000004488.1.96796 WP_000004488.1.96817 WP_000004488.1.96820 WP_000004488.1.96850 WP_000004488.1.96864 WP_000004488.1.96894 WP_000004488.1.9690 WP_000004488.1.9691 WP_000004488.1.96924 WP_000004488.1.96932 WP_000004488.1.96936 WP_000004488.1.96944 WP_000004488.1.96971 WP_000004488.1.96984 WP_000004488.1.96989 WP_000004488.1.97011 WP_000004488.1.97049 WP_000004488.1.97059 WP_000004488.1.9708 WP_000004488.1.97119 WP_000004488.1.97123 WP_000004488.1.97170 WP_000004488.1.97193 WP_000004488.1.97195 WP_000004488.1.97200 WP_000004488.1.97231 WP_000004488.1.97238 WP_000004488.1.97247 WP_000004488.1.97248 WP_000004488.1.97279 WP_000004488.1.9729 WP_000004488.1.97344 WP_000004488.1.97356 WP_000004488.1.97360 WP_000004488.1.97361 WP_000004488.1.97379 WP_000004488.1.9740 WP_000004488.1.97402 WP_000004488.1.97418 WP_000004488.1.97421 WP_000004488.1.97434 WP_000004488.1.97439 WP_000004488.1.97459 WP_000004488.1.97464 WP_000004488.1.9747 WP_000004488.1.97490 WP_000004488.1.97513 WP_000004488.1.97527 WP_000004488.1.97544 WP_000004488.1.97571 WP_000004488.1.97619 WP_000004488.1.97632 WP_000004488.1.97667 WP_000004488.1.97675 WP_000004488.1.97677 WP_000004488.1.97685 WP_000004488.1.9770 WP_000004488.1.97705 WP_000004488.1.97711 WP_000004488.1.97775 WP_000004488.1.97789 WP_000004488.1.97798 WP_000004488.1.978 WP_000004488.1.97802 WP_000004488.1.97815 WP_000004488.1.97822 WP_000004488.1.97825 WP_000004488.1.97871 WP_000004488.1.97890 WP_000004488.1.97895 WP_000004488.1.97919 WP_000004488.1.97930 WP_000004488.1.97932 WP_000004488.1.97937 WP_000004488.1.97962 WP_000004488.1.97982 WP_000004488.1.97996 WP_000004488.1.98000 WP_000004488.1.98005 WP_000004488.1.98012 WP_000004488.1.9803 WP_000004488.1.98046 WP_000004488.1.98082 WP_000004488.1.98083 WP_000004488.1.981 WP_000004488.1.98115 WP_000004488.1.98139 WP_000004488.1.98155 WP_000004488.1.9816 WP_000004488.1.98167 WP_000004488.1.9817 WP_000004488.1.98176 WP_000004488.1.98187 WP_000004488.1.98205 WP_000004488.1.98208 WP_000004488.1.98220 WP_000004488.1.98232 WP_000004488.1.98235 WP_000004488.1.98239 WP_000004488.1.98241 WP_000004488.1.98244 WP_000004488.1.98279 WP_000004488.1.98284 WP_000004488.1.98292 WP_000004488.1.98294 WP_000004488.1.98301 WP_000004488.1.98312 WP_000004488.1.98323 WP_000004488.1.98355 WP_000004488.1.98357 WP_000004488.1.98384 WP_000004488.1.98400 WP_000004488.1.98424 WP_000004488.1.98429 WP_000004488.1.9844 WP_000004488.1.98442 WP_000004488.1.98466 WP_000004488.1.98477 WP_000004488.1.98498 WP_000004488.1.98543 WP_000004488.1.98549 WP_000004488.1.98569 WP_000004488.1.98578 WP_000004488.1.9858 WP_000004488.1.98587 WP_000004488.1.98603 WP_000004488.1.98614 WP_000004488.1.98626 WP_000004488.1.98628 WP_000004488.1.98641 WP_000004488.1.98654 WP_000004488.1.98665 WP_000004488.1.98668 WP_000004488.1.98683 WP_000004488.1.98702 WP_000004488.1.98776 WP_000004488.1.98784 WP_000004488.1.98795 WP_000004488.1.9883 WP_000004488.1.98875 WP_000004488.1.98886 WP_000004488.1.98908 WP_000004488.1.98920 WP_000004488.1.98976 WP_000004488.1.98988 WP_000004488.1.99029 WP_000004488.1.99046 WP_000004488.1.99053 WP_000004488.1.9907 WP_000004488.1.99101 WP_000004488.1.99110 WP_000004488.1.99119 WP_000004488.1.99168 WP_000004488.1.99182 WP_000004488.1.99209 WP_000004488.1.99234 WP_000004488.1.99246 WP_000004488.1.99265 WP_000004488.1.99289 WP_000004488.1.99292 WP_000004488.1.99295 WP_000004488.1.99302 WP_000004488.1.99304 WP_000004488.1.99310 WP_000004488.1.99319 WP_000004488.1.99334 WP_000004488.1.99345 WP_000004488.1.9935 WP_000004488.1.99361 WP_000004488.1.99366 WP_000004488.1.99392 WP_000004488.1.9940 WP_000004488.1.99400 WP_000004488.1.99427 WP_000004488.1.99453 WP_000004488.1.99471 WP_000004488.1.99475 WP_000004488.1.99486 WP_000004488.1.99487 WP_000004488.1.99501 WP_000004488.1.99511 WP_000004488.1.99562 WP_000004488.1.99592 WP_000004488.1.99602 WP_000004488.1.99603 WP_000004488.1.99619 WP_000004488.1.99632 WP_000004488.1.99641 WP_000004488.1.99666 WP_000004488.1.99692 WP_000004488.1.99698 WP_000004488.1.99734 WP_000004488.1.99774 WP_000004488.1.99791 WP_000004488.1.99804 WP_000004488.1.99827 WP_000004488.1.99869 WP_000004488.1.99892 WP_000004488.1.99912 WP_000004488.1.99929 WP_000004488.1.99986 YP_002409589.1.10275 YP_002414330.1.14968 YP_006777327.1.12065 YP_404854.2.10455 gi|260846004|ref|YP_003223782.1| gi|170018559|ref|YP_001723513.1| gi|170082725|ref|YP_001732045.1| gi|38704148|ref|NP_312097.2| gi|386711098|ref|YP_006174819.1| gi|218555761|ref|YP_002388674.1| gi|260869942|ref|YP_003236344.1| gi|238902293|ref|YP_002928089.1| gi|157157685|ref|YP_001464668.1| gi|387508595|ref|YP_006160851.1| gi|383180371|ref|YP_005458376.1| gi|254795140|ref|YP_003079977.1| gi|443619264|ref|YP_007383120.1| gi|209397627|ref|YP_002272661.1| gi|218706811|ref|YP_002414330.1| gi|544391676|ref|YP_008566357.1| gi|251786461|ref|YP_003000765.1| gi|387608913|ref|YP_006097769.1| gi|209920666|ref|YP_002294750.1| gi|90111556|ref|NP_417658.4| gi|254163133|ref|YP_003046241.1| gi|407471165|ref|YP_006782392.1| gi|157162675|ref|YP_001459993.1| gi|388479184|ref|YP_491376.1| gi|260857318|ref|YP_003231209.1| gi|170684008|ref|YP_001745463.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]