SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 331271.Bcen_0684 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  331271.Bcen_0684
Domain Number 1 Region: 144-419
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.27e-84
Family D-glucarate dehydratase-like 0.000000000753
Further Details:      
 
Domain Number 2 Region: 12-142
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.43e-33
Family Enolase N-terminal domain-like 0.00000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 331271.Bcen_0684
Sequence length 450
Comment (Burkholderia cenocepacia AU 1054)
Sequence
MNAVTASPSHDTPRIVDLQAIPVAGHDSMLLNLSGAHGPFFTRNLVILKDSAGRTGVGEV
PGGESIRRTLDDARALVVGQPVGNYHAVLNDVRRTFADRDASGRGLQTFDLRTTIHAVTA
LEAALLDLLGQHLGVPVAALLGEGQQRERVEMLGYLFYIGDRTKTALPYRDGRGATDDWT
RVRDEAALTPEAVVRLAEAAHARYGFNDFKLKGGVFEGASEIEAVTALAERFPDARVTLD
PNGAWSLDEAVRLCRDQHHVLAYAEDPCGAENGYSGREVMAEFRRATGLPTATNMIATDW
RQMGHAVQLHAVDIPLADPHFWTMQGSVRVAQMCRDWGLTWGSHSNNHFDVSLAMFTHVA
AAAPGQVTAIDTHWIWQDGERLTREPLKIENGLVEVPKRPGLGIDIDMDAVALAHELYKQ
HGLGARDDAAAMQYLIPGWTFNNKRPCLVR
Download sequence
Identical sequences A0A0H2XMG5 A0A1U9MP53 B1JYF8 V4ZZN6
331271.Bcen_0684 331272.Bcen2424_1163 406425.Bcenmc03_1139 gi|116689185|ref|YP_834808.1| gi|170732489|ref|YP_001764436.1| WP_011544970.1.27194 WP_011544970.1.43430 WP_011544970.1.44577 WP_011544970.1.5101 WP_011544970.1.64260 WP_011544970.1.90247 WP_011544970.1.90614 WP_011544970.1.96618 gi|107022240|ref|YP_620567.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]