SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 331271.Bcen_2326 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  331271.Bcen_2326
Domain Number 1 Region: 731-946
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.16e-23
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.02
Further Details:      
 
Domain Number 2 Region: 27-228
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.53e-16
Family Pyruvate oxidase and decarboxylase Pyr module 0.085
Further Details:      
 
Domain Number 3 Region: 441-628
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000000715
Family Pyruvate oxidase and decarboxylase PP module 0.033
Further Details:      
 
Weak hits

Sequence:  331271.Bcen_2326
Domain Number - Region: 276-398
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00235
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 331271.Bcen_2326
Sequence length 1190
Comment (Burkholderia cenocepacia AU 1054)
Sequence
MTARLPVDGTPALSDYRLTDNLTATRGRIFLTGTQALIRLLLMQRAVDTEQGLNTAGFVS
GYRGSPLGMVDQQLWKAKKLLDASSVRFLPAINEELGGTAVLGTQRVEADPERTVEGVYA
MWYGKGPGVDRAGDALKHGNAYGSSPHGGVLVVAGDDHGCVSSSMPHQSDFAMMAWHMPV
VNPSNIADMLEFGLYGWALSRYSGAWVGFKAISETVESGSTVDLDALQTRWPAPEGFTPP
AGGLHNRWPDLPSLTIEARLAAKLDAVRHFARANSIDKWIAPSAQANVGIVTCGKAHLDL
MEALRRLDLTVADLDAAGVRIYKVGLSYPLEMTRIETFVDGLAEVLVIEEKGPVIEQQIK
DYLYNRTEGARPRVLGKHDAAGACLLSELGELRPSRILPVFAAWLARHKPALDRRERVVD
LVAPQILSNEADAVKRTPYFCSGCPHNTSTKVPEGSIAQAGIGCHFMASWMERDTTGLIQ
MGGEGVDWAAHAMFTNTKHVFQNLGDGTYFHSGILAIRQAVAAKANITYKILYNDAVAMT
GGQPVDGSISVPQIARQVEAEGVSRFVVVSDEPEKYDGHHGQFPTGTTFHHRSELDAVQR
ELRETPGVTVLIYDQTCAAEKRRRRKKGEFPDPDKRLFINDAVCEGCGDCGVQSNCLSVE
PLETPLGRKRRIDQSSCNKDYSCVNGFCPSFVTVEGAALKKAAGAAFDEAALAARVDALP
VPATHLDAAPFDMLVTGVGGTGVVTVGALISMAAHLEGKSASVLDFMGFAQKGGSVLSFV
RIASSDRWLNQVRIDTQQADVLLACDMVVGASAEALQTVRHARTRIVVNTHRIPNASFVQ
NPDANLHADALLEKMHHAAGDGYLSSCDAQALAAKFLGDSIGANILMLGYAWQLGLVPVS
LAAMMRAIELNNVAVPMNKLAFSIGRMAAGDAAGLDALWNARHAVAVHAAPETLAELIAD
REARLDAYGGARYVERYRALVNAARAKGDDALTRAVATTFYRLLAVKDEYEVARLYTDDA
FRTALEAQFEGVPGQTYRVKFNLAPPTVAKAGSDGSTPKKRVFGQWMWPVFGMLARVRSL
RGTWLDPFGRTVERKMERALADDYETTLTRAFAAMTPGNAAQVVQLADLHARVRGFGHVK
VRNLAGVKRAERELALQLGIDAATSAAVQHTLDEMKGAGTLKGIPVVVAK
Download sequence
Identical sequences A0A0H2XQX9 A0A1U9MU39
331271.Bcen_2326 331272.Bcen2424_2940 WP_011546346.1.27194 WP_011546346.1.43430 WP_011546346.1.96618 gi|107023873|ref|YP_622200.1| gi|116690958|ref|YP_836581.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]