SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 331271.Bcen_3326 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  331271.Bcen_3326
Domain Number 1 Region: 183-424
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.23e-71
Family D-glucarate dehydratase-like 0.00000011
Further Details:      
 
Domain Number 2 Region: 4-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.19e-40
Family Enolase N-terminal domain-like 0.00000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 331271.Bcen_3326
Sequence length 425
Comment (Burkholderia cenocepacia AU 1054)
Sequence
MPIIRSMRVLDVRFPTSRQLDGSDAMNPDPDYSAAYVVLETDRDGLEGHGLTFTIGRGNE
ICCAAIDAMRHLVVGLDLDWIREDMGRFWRHVTSDSQLRWIGPDKGAIHLATGAVVNAVW
DLWAKAVGKPLWRLVADLSPEELARAIDFRYLTDCLSPDEALDLLRRQAPGKAARIAALE
RDGYPCYTTSAGWLGYSDDKLRRLCREAVDEGFEYVKLKVGANLEDDIRRVTIAREVIGP
DRKLMIDANQVWEVDEAIDWVRELAFARPWFIEEPTSPDDVEGHRKIREAIAPVQVATGE
MCQNRVLFKQFIARGAIDVVQIDACRLGGVNEILAVMLMAAKYGLPVCPHAGGVGLCEYV
QHLSMIDYVCISGTKEGRVTEYVDHLHEHFVEPCVVRGAAYMPPTAPGFSIEMKPESLEQ
YRFRG
Download sequence
Identical sequences A0A0H2XVH0 A0A2K0ML21
331271.Bcen_3326 331272.Bcen2424_5041 gi|107025683|ref|YP_623194.1| WP_011547134.1.43430 WP_011547134.1.96618 gi|116693135|ref|YP_838668.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]