SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 331271.Bcen_3402 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  331271.Bcen_3402
Domain Number 1 Region: 56-161,195-253
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.92e-25
Family Clp protease, ClpP subunit 0.072
Further Details:      
 
Domain Number 2 Region: 430-504
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000017
Family NfeD domain-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 331271.Bcen_3402
Sequence length 519
Comment (Burkholderia cenocepacia AU 1054)
Sequence
MRFHRHGPPPAPAAPDGRPRHPLSARVARAALFAALLVVCAAVAAPPAADAPAAHPVVVI
PVNGAIGPASADFIVRSLDRAAREHAPLAILQLDTPGGLDTSMRQIIKAILGSPVPVAAF
VAPGGARAASAGTYIVYASHVAAMAPGTNLGAASPVQFGIGGGAPPGANPGAPRPTGASG
ASGASGVSDAAAMLLTDTQSTEIRKAMQDASAYIRGLAQLRGRNAEWAERAVREAVSLSA
NEARAQHVVDLIAQDPADLARQLDGRAVTTTAGTLHLATAHAPLVVLAPDWRSRFLAIIA
DPNVALILLTIGIYGLFFEFANPGFVLPGVAGTICLLVGLFAMQLLPVSYAGLGLVLLGL
GCLVAEAFLPTFGVLGFGGIVAFTIGALMLIDTDVPGYGIPWPVIASLALGGALLVAGVS
SVALRARRRPVVTGAEAMLGSIGEVLDDGLQPDQPPGAAGAPSSAAGWARVHGERWRVAS
STPLAAGCRVRVTGRHGLTLTVAPLYDAPAPAHPQGEPS
Download sequence
Identical sequences A0A0H2XVP7 A0A1U9MZW7
331271.Bcen_3402 331272.Bcen2424_4965 gi|107025759|ref|YP_623270.1| gi|116693059|ref|YP_838592.1| WP_011547200.1.27194 WP_011547200.1.43430 WP_011547200.1.5376 WP_011547200.1.96618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]