SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 331271.Bcen_4593 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  331271.Bcen_4593
Domain Number 1 Region: 119-373
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.28e-62
Family D-glucarate dehydratase-like 0.000000337
Further Details:      
 
Domain Number 2 Region: 7-132
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 8.25e-34
Family Enolase N-terminal domain-like 0.00000637
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 331271.Bcen_4593
Sequence length 377
Comment (Burkholderia cenocepacia AU 1054)
Sequence
MIATAATIERIETLLVDVPTIRPHKLSVATMNCQTLVLVRVRCTDGIEGVGEATTIGGLA
YGEESPESIKVNIDTYFAPLLQGLDATRPGAALARARKLFQGNRFAKCAIETALFDAQAR
RLGVPLSELFGGRRTDTVDVAWTLASGDTQRDIAEAEAMLDARRHRAFKLKIGSNAVADD
VAHVVAIKRALGERGDVRVDVNQAWSETDAIWAGARLADAGVSLVEQPIAATNRAGLKRL
TQLAQVPIMADEALHGAVDAFALAQDRAADVFAVKIAQSGGLQGAASVASIAAAAGIELY
GGTMLEGAAGTMASAQLFSTFDSLKWGTELFGPLLLTEEILVEPLRYEDFKLHLPATPGL
GITFDWARIERMRRGAR
Download sequence
Identical sequences A0A0H2XZ34 A0A2K0MPB9
gi|116691867|ref|YP_837400.1| 331271.Bcen_4593 331272.Bcen2424_3770 gi|107026936|ref|YP_624447.1| WP_011548241.1.43430 WP_011548241.1.5376 WP_011548241.1.96618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]